Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, keep working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
pilD; xcpA; Prepilin leader peptidase/N-methyltransferase; Protein PilD; Protein secretion protein XCPA [Includes: Leader peptidase; Prepilin peptidase; N-methyltransferase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Pseudomonas putida (Arthrobacter siderocapsulatus)
Target Names
pilD
Target Protein Sequence
MTLWTFLAMEPAYFITLATVLGLLVGSFLNVVVYRLPIMLERQWQREAHEVLGLPVTEHE RFDLCLPASQCTQCGHRIRAWENLPVLSYLALRGRCSACKQRISVRYPLVEVGCALLSMV VAWRYGASVEALVLLPLTWSLLALSLIDHDQQLLPDAIVLPGLWLGLIVNYFGVWVPLPD AVCGAVVGYLSLWTVYWLFKLVTGKEGMGYGDFKLLALLGAWGGWQVLPLTLLLSSVLGA LVGVYLLRVRNDSMGTAMPFGPYLAIAGWIAVLWGDEIYASNMQLLGF
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in the formation of type IV pili and type II pseudopili. It proteolytically removes the leader sequence from substrate proteins and subsequently monomethylates the alpha-amino group of the newly exposed N-terminal phenylalanine.
Protein Families
Peptidase A24 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of pilD in Pseudomonas putida?

The pilD gene in Pseudomonas putida encodes a peptidase that serves a dual function in bacterial physiology. Its primary role is processing the precursors of pilin subunits, which are essential for the assembly of type IV pili. Additionally, pilD processes several components of the protein secretion apparatus. The enzyme contains prepilin processing activity, which was demonstrated in P. putida WCS358 strains, suggesting its involvement in type IV pili biogenesis even in non-pathogenic strains .

The protein functions by cleaving leader peptides from the N-terminal region of prepilin proteins, a critical step that allows for subsequent assembly of these processed proteins into functional pili structures. Through this mechanism, pilD contributes to bacterial motility, adhesion to surfaces, DNA uptake during transformation, and protein secretion across the outer membrane.

How does the pilD gene relate to other pilus assembly genes in P. putida?

The pilD gene in P. putida exists in a genomic context alongside other pilus-related genes. Nucleotide sequencing revealed that in P. putida, the pilD gene (also referred to as xcpA) is positioned adjacent to pilA and pilC genes. These genes show high homology to those involved in the biogenesis of type IV pili in other bacteria . The pilA gene encodes the pilin subunit itself, while pilC is an accessory gene required for the assembly of these subunits into functional pili structures .

Interestingly, the P. putida pil gene cluster differs from that of P. aeruginosa in that it lacks a homologous pilB gene. This difference in genetic organization potentially explains why pili were not directly detected on the cell surface of P. putida, even when pilA was overexpressed from a tac promoter on a plasmid . This suggests that P. putida may require additional factors for complete pilus biogenesis that weren't expressed under the experimental conditions tested.

What is the relationship between pilD and bacterial adaptation to environmental conditions?

The pilD gene product contributes to bacterial adaptation through its involvement in pilus assembly and protein secretion. In long-term stationary phase (LTSP) studies, P. putida demonstrates remarkable abilities to persist and adapt genetically under prolonged resource exhaustion . While pilD wasn't specifically highlighted as a primary mutation target in the LTSP adaptation studies, the type IV pilus system it supports is likely involved in the bacterium's ability to adapt to changing environmental conditions.

P. putida is known for its metabolic versatility and ability to survive in challenging environments, including soils and sediments with high levels of heavy metals and organic contaminants . The secretion systems and adhesion mechanisms facilitated by pilD likely contribute to these adaptive capabilities, allowing the bacterium to interact effectively with its environment during times of stress.

What methodologies are most effective for expressing and purifying recombinant P. putida pilD?

Recombinant P. putida pilD can be effectively expressed in E. coli expression systems, similar to the approach used for P. aeruginosa pilD . Based on available data, the following methodological approach is recommended:

Expression System:

  • Host: E. coli (BL21 or similar strain optimized for membrane protein expression)

  • Vector: pET-based with N-terminal His-tag for purification

  • Promoter: T7 or tac promoter for controlled induction

Expression Protocol:

  • Transform expression vector into E. coli

  • Grow cultures at 30°C to mid-log phase (OD600 ~0.6)

  • Induce with IPTG (0.1-0.5 mM) at reduced temperature (16-20°C)

  • Continue expression for 16-18 hours

  • Harvest cells by centrifugation

Purification Strategy:

  • Lyse cells in buffer containing mild detergents (e.g., 1% Triton X-100) to solubilize membrane-associated pilD

  • Purify using Ni-NTA affinity chromatography

  • Further purify by size exclusion chromatography

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Lyophilize for long-term storage

Reconstitution:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage at -20°C/-80°C

This approach has been shown to yield proteins with greater than 90% purity as determined by SDS-PAGE , suitable for downstream applications including enzymatic assays and structural studies.

How can researchers assess the enzymatic activity of recombinant pilD in vitro?

To evaluate the enzymatic activity of recombinant pilD, researchers can employ several complementary approaches:

Prepilin Processing Assay:

  • Generate synthetic prepilin peptide substrates based on the N-terminal sequence of pilA

  • Incubate purified pilD with the substrate in appropriate buffer (typically containing divalent cations)

  • Analyze cleavage products using:

    • Mass spectrometry to determine precise cleavage sites

    • SDS-PAGE to visualize size differences between processed and unprocessed peptides

    • HPLC to separate and quantify reaction products

Complementation Studies:
The activity of recombinant P. putida pilD can be verified through complementation of pilD (xcpA) mutations in P. aeruginosa. As demonstrated in previous research, the cloned P. putida pilD gene was capable of functionally complementing a pilD (xcpA) mutation in P. aeruginosa . This approach provides a powerful tool to confirm that the recombinant enzyme retains its native function.

N-methyltransferase Activity Assessment:
Beyond its peptidase activity, pilD also functions as an N-methyltransferase. This secondary activity can be measured by:

  • Incubating purified pilD with processed pilin peptides and S-adenosylmethionine (SAM)

  • Detecting methylated products through radiolabeling with [³H]-SAM or mass spectrometry

Kinetic Analysis:
For more detailed characterization, researchers should determine enzyme kinetics using varying substrate concentrations and measuring initial reaction rates to calculate Km, Vmax, and catalytic efficiency (kcat/Km) values.

What comparative analysis can be made between pilD in P. putida and other Pseudomonas species?

The pilD gene from P. putida shows important similarities and differences when compared to other Pseudomonas species, particularly P. aeruginosa:

Sequence Homology:
Studies revealed high sequence homology between the pilD genes of P. putida and P. aeruginosa, indicating evolutionary conservation of this essential enzyme . Both proteins function as dual-activity enzymes with peptidase and N-methyltransferase capabilities.

Genetic Organization:
A significant difference lies in the organization of the pil gene cluster. In P. putida, the pilD gene is adjacent to pilA and pilC, but notably lacks a homologous pilB gene that is present in P. aeruginosa . This difference in genetic architecture may explain the observed phenotypic variations in pilus expression between these species.

Functional Conservation:
Despite differences in genetic organization, the P. putida pilD gene demonstrates remarkable functional conservation, as evidenced by its ability to complement pilD (xcpA) mutations in P. aeruginosa . This suggests that the core enzymatic function is preserved across species.

Protein Localization and Membrane Association:
Both P. putida and P. aeruginosa pilD proteins are membrane-associated enzymes with similar predicted transmembrane domains. The P. aeruginosa pilD protein has a length of 290 amino acids , and the P. putida homolog likely has a similar size based on functional complementation studies.

Expression Differences:
A notable distinction is that while P. aeruginosa readily expresses functional type IV pili, pili were not detected on the cell surface of P. putida, even with pilA overexpression . This suggests different regulatory mechanisms or additional requirements for pilus assembly in P. putida.

Cross-Species Functionality:
Interestingly, when the P. putida pilA gene was expressed in P. aeruginosa, it resulted in the production of pili containing P. putida PilA subunits . This demonstrates that the P. aeruginosa pilus assembly machinery can recognize and process P. putida components, indicating structural compatibility between the systems.

What role does pilD play in P. putida colonization of plant roots?

The pilD enzyme contributes significantly to P. putida's ability to colonize plant roots, a process important for this bacterium's function as a plant growth-promoting rhizobacterium:

Root Colonization Mechanisms:
Research into factors that contribute to the ability of plant growth-stimulating P. putida WCS358 to colonize plant roots has identified the importance of pilus biosynthesis genes, including pilD . The type IV pili facilitated by pilD likely enhance bacterial attachment to root surfaces, an essential first step in colonization.

Biofilm Formation:
The pilD enzyme, through its role in type IV pili biogenesis, contributes to biofilm formation on plant surfaces. Type IV pili are known to be crucial for initial surface attachment and subsequent biofilm development, allowing P. putida to establish stable associations with plant roots.

Protein Secretion:
Beyond pilus assembly, pilD's role in protein secretion is significant for plant-microbe interactions. The secretion of enzymes, siderophores, and other bioactive compounds by P. putida contributes to its beneficial effects on plant growth and health.

Ecological Adaptations:
P. putida strains serve as rhizospheric and endophytic bacteria, promoting plant growth . The pilD gene likely contributes to the bacterium's adaptability to the rhizosphere environment, allowing it to thrive in this ecological niche and form beneficial associations with plants.

Competitive Fitness:
The ability to process prepilins efficiently may confer a competitive advantage to P. putida in the rhizosphere, allowing for rapid adaptation to changing conditions in this dynamic environment. This adaptability is particularly important considering P. putida's diverse metabolic capabilities and its ability to survive in soils with varying compositions .

How does long-term stationary phase (LTSP) adaptation affect pilD expression and function in P. putida?

While the search results don't specifically address pilD expression during LTSP adaptation, we can infer relevant insights from the broader adaptive responses observed in P. putida under prolonged resource exhaustion:

Adaptive Genetic Changes:
During LTSP, P. putida populations show accumulation of mutations in a highly convergent manner, with similar loci being mutated across independently evolving populations . The protein secretion and pilus assembly systems, in which pilD plays a crucial role, may undergo selective pressure during this adaptation process.

Mutation Patterns:
LTSP adaptation in P. putida shows enrichment in nonsynonymous versus synonymous mutations, with dN/dS ratios significantly higher than 1 across populations (Table 1 from source ), indicating positive selection:

Population# nonsynonymous mutations# synonymous mutationsdN/dSP-value
14271.97<<0.001
2260Cannot be calculated<<0.001
32451.57<<0.001

While pilD itself wasn't specifically identified among the convergently mutated genes in the study, the general pattern of adaptive mutations suggests that genes involved in surface structures and secretion systems may be subject to selective pressure during LTSP adaptation.

Resource Recycling:
During LTSP, bacteria survive by recycling resources from deceased cells . The protein secretion systems facilitated by pilD potentially contribute to this recycling process, allowing cells to access external nutrients through secreted enzymes.

Regulatory Network Changes:
P. putida adaptation under LTSP involves changes to global regulatory networks, similar to observations in E. coli but with species-specific targets . These regulatory changes could potentially affect pilD expression and the broader type IV pilus system during long-term survival.

What methodological approaches can be used to study pilD regulation in P. putida?

To investigate the regulation of pilD in P. putida, researchers can employ a variety of complementary techniques:

Transcriptional Analysis:

  • RT-qPCR: Quantify pilD mRNA levels under various growth conditions and environmental stresses

  • RNA-Seq: Profile global transcriptional changes, placing pilD regulation in the context of broader gene expression networks

  • Promoter Fusion Assays: Create reporter gene fusions (e.g., lacZ, gfp) to the pilD promoter to monitor promoter activity under different conditions

Protein Expression Analysis:

  • Western Blotting: Use specific antibodies against pilD to quantify protein levels

  • Mass Spectrometry: Employ proteomic approaches to identify post-translational modifications

  • Pulse-Chase Experiments: Determine pilD protein stability and turnover rates

Regulatory Network Identification:

  • DNA Affinity Purification: Identify transcription factors that bind to the pilD promoter

  • ChIP-Seq: Map genome-wide binding of identified regulatory proteins

  • Bacterial Two-Hybrid Assays: Detect protein-protein interactions involving pilD

Genetic Approaches:

  • Deletion Analysis: Create deletion mutations in potential regulatory genes to assess effects on pilD expression

  • Site-Directed Mutagenesis: Modify putative regulatory sequences in the pilD promoter to confirm their functionality

  • Complementation Studies: Express pilD under control of heterologous promoters to bypass native regulation

Environmental Response Assessment:
Measure pilD expression under conditions relevant to P. putida's ecological niche:

  • Plant root exudate exposure

  • Nutrient limitation scenarios

  • Varying oxygen tensions

  • Biofilm formation conditions

  • Long-term stationary phase conditions similar to those described in

These methodological approaches would provide comprehensive insights into the regulatory mechanisms controlling pilD expression in P. putida, enhancing our understanding of how this bacterium modulates its adhesion and secretion systems in response to environmental changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.