Recombinant Pseudomonas putida Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Role of UppP in Bacterial Physiology

UppP is an integral membrane protein that ensures the regeneration of UP, the universal glycan lipid carrier required for cell wall assembly. Its enzymatic activity enables the recycling of UPP, which is released after peptidoglycan precursors are incorporated into the growing cell wall . Key functional aspects include:

  • Catalytic mechanism: UppP hydrolyzes the pyrophosphate bond in UPP, releasing inorganic phosphate and UP .

  • Essentiality: Genetic studies in Bacillus subtilis and Escherichia coli demonstrate that UppP and its homolog BcrC form a synthetic lethal pair, underscoring their non-redundant roles in cell viability .

  • Antibiotic target: UppP is inhibited by bacitracin, which sequesters UPP and disrupts UP homeostasis, leading to cell lysis .

Recombinant Production in P. putida

P. putida is a robust platform for recombinant enzyme production due to its genetic tractability and stress resistance . Key advancements in UppP expression include:

Genetic Engineering Strategies

  • Markerless gene deletion: The upp gene (encoding UppP) serves as a counterselectable marker in P. putida, enabling precise chromosomal integrations and deletions .

  • CRISPR/Cas9 systems: Recent tools allow efficient curing of helper plasmids and targeted genomic modifications, streamlining UppP overexpression .

Table 2: Genetic Tools for UppP Engineering in P. putida

Tool/TechniqueApplicationEfficiency
upp-based counterselectionGene deletions/insertions10–40%
RecET recombineeringLarge DNA fragment integrationHigh
Thermoinducible systemsSingle-stranded DNA recombineeringModerate

Expression Optimization

  • Promoter selection: Inducible promoters (e.g., Ptac) enhance UppP yields while avoiding toxicity .

  • Strain engineering: Deletion of competing pathways (e.g., polyhydroxyalkanoate synthesis) redirects metabolic flux toward UPP recycling .

Enzymatic Activity and Kinetic Parameters

Studies on E. coli UppP homologs provide insights into catalytic efficiency:

Table 3: Kinetic Properties of UppP

ParameterValueConditions
KmK_m (UPP)0.8 µMpH 7.5, 37°C
kcatk_{cat}12 s1^{-1}pH 7.5, 37°C
Optimal pH range6.5–8.0

Activity assays reveal that UppP operates at the membrane interface, requiring phospholipid bilayers for full functionality .

Biofuel and Biopolymer Production

  • UppP activity supports the synthesis of rhamnolipids and polyhydroxyalkanoates in engineered P. putida strains .

  • Overexpression of UppP increases precursor availability for lipid-linked glycan biosynthesis .

Antibiotic Adjuvant Development

  • Inhibitors targeting UppP could potentiate existing antibiotics by disrupting cell wall integrity .

Challenges and Future Directions

  • Structural characterization: A high-resolution structure of P. putida UppP remains elusive, hindering rational engineering .

  • Industrial scaling: Enhancing UppP stability in bioreactors requires codon optimization and fusion tags .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Pput_2827; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Target Names
uppP
Target Protein Sequence
MDFWTAFQAIILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAMAFNIIIQLAAILAVV WEFRSKIFEVVFGLTHQPKARRFTGNLLLAFMPAVVLGVLFADLIHEYLFNPVTVAAALV VGGVIMLWAERRKHRVEVDHVDDMRWSHALKIGFIQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRDLFQPGDLPVFALGFVTSFIFAMIAVRALLKF IANHSYAAFAWYRIVFGLFILATWQFGWVDWSTAHG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas putida Undecaprenyl-diphosphatase (uppP) and what is its primary function?

Pseudomonas putida Undecaprenyl-diphosphatase (uppP) is a membrane-associated enzyme (EC 3.6.1.27) that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate. This reaction is crucial in the recycling pathway of the lipid carrier involved in bacterial cell wall biosynthesis. The enzyme plays a key role in peptidoglycan synthesis by regenerating the lipid carrier molecule necessary for transporting cell wall precursors across the cytoplasmic membrane .

Methodologically, researchers can study uppP function through:

  • Enzyme activity assays measuring pyrophosphate release

  • Membrane fraction isolation and activity determination

  • Complementation studies in uppP-deficient bacterial strains

  • Growth inhibition assays in the presence of cell wall-targeting antibiotics

How can I experimentally confirm the enzymatic activity of recombinant Pseudomonas putida uppP?

To confirm enzymatic activity of recombinant uppP, researchers should implement a multi-faceted approach:

  • Phosphatase activity assay: Measure the release of inorganic phosphate from undecaprenyl pyrophosphate substrate using colorimetric methods (malachite green assay) or radioactive substrates.

  • Complementation studies: Express recombinant uppP in bacterial strains with uppP deletion or conditional mutations and assess their ability to grow in the presence of cell wall-targeting antibiotics.

  • Bacitracin resistance testing: Since uppP functions as a bacitracin resistance protein, measure changes in minimum inhibitory concentration (MIC) of bacitracin in strains expressing recombinant uppP versus controls .

  • Substrate specificity analysis: Test activity against various pyrophosphate substrates to confirm specificity for undecaprenyl pyrophosphate.

Data should be presented as specific activity (μmol phosphate released/min/mg protein) under standardized conditions (pH, temperature, metal cofactors).

What are the key considerations in designing experiments to study Pseudomonas putida uppP function?

When designing experiments to study uppP function, researchers should apply systematic experimental design principles and consider multiple variables:

Experimental variables to control:

  • pH (typically 6.5-8.0 for membrane enzymes)

  • Temperature (25-37°C depending on assay)

  • Metal cofactors (Mg²⁺, Mn²⁺, or Zn²⁺)

  • Detergent concentration for solubilization

  • Substrate concentration range (for kinetic studies)

Experimental design approach:

  • Start with a specific, testable hypothesis about uppP function

  • Manipulate independent variables (e.g., substrate concentration, pH)

  • Measure dependent variables (enzyme activity, growth rate)

  • Include appropriate controls (heat-inactivated enzyme, catalytic site mutants)

  • Consider both between-subjects and within-subjects designs when appropriate

Experimental ApproachKey VariablesAppropriate ControlsData Analysis Method
Enzyme kineticsSubstrate concentration, pH, tempHeat-inactivated enzymeMichaelis-Menten plots
ComplementationExpression level, growth conditionsEmpty vectorSurvival curves
Antibiotic resistanceBacitracin concentrationNon-expressing strainsMIC determination
MutagenesisAmino acid substitutionsWild-type enzymeActivity comparison

What expression systems are most effective for producing functional recombinant Pseudomonas putida uppP?

For optimal expression of functional Pseudomonas putida uppP, researchers should consider several expression systems based on research goals:

  • Homologous expression in Pseudomonas species:

    • Advantages: Native cellular environment, proper folding, correct membrane insertion

    • Systems: pS2514 or pS2311 vectors with thermal or chemical induction systems

    • Method: Express under control of regulated promoters like XylS/Pm or ChnR/PchnB

  • Heterologous expression in E. coli:

    • Advantages: Higher yields, established protocols

    • Systems: pET vectors with T7 promoter, C43(DE3) or C41(DE3) strains designed for membrane proteins

    • Considerations: May require optimization of codons for E. coli usage

  • Cell-free expression systems:

    • Advantages: Rapid screening, avoids toxicity issues

    • Methodology: Incorporate nanodiscs or liposomes to provide membrane environment

For membrane proteins like uppP, expression must be optimized to ensure proper membrane integration. P. putida offers particular advantages for expression of certain proteins due to its versatile metabolism and tolerance to xenobiotics .

How can the mismatch repair system be manipulated to study mutations in Pseudomonas putida uppP?

The mismatch repair (MMR) system can be strategically manipulated to study uppP mutations through these methodological approaches:

  • Conditional mutator phenotype induction:

    • Construct inducible expression systems for dominant-negative MutL alleles (e.g., E36K mutL)

    • Use regulated promoters on broad-host-range plasmids for transient MMR inhibition

    • Induce expression thermally (40°C for 15 min) or chemically (1 mM cyclohexanone)

    • This approach increases mutation frequency up to 438-fold

  • Targeted mutagenesis of uppP:

    • Apply transient MMR inhibition to increase random mutations in the uppP gene

    • Screen for altered phenotypes (e.g., changes in bacitracin resistance)

    • Sequence uppP variants to identify mutations affecting function

  • Experimental workflow:

    • Transform P. putida with mutator device (e.g., pS2514(SG)M)

    • Culture cells in non-selective medium to OD₆₀₀ of 0.3

    • Induce MMR inhibition

    • Continue growth to desired phase (early exponential, mid-exponential, or stationary)

    • Plate on selective media to identify mutants with altered phenotypes

This approach allows researchers to generate and study a library of uppP variants with potentially altered functions, substrate specificities, or regulatory properties.

How does Pseudomonas putida uppP contribute to antibiotic resistance mechanisms?

Pseudomonas putida uppP plays a significant role in antibiotic resistance through multiple mechanisms that can be experimentally investigated:

  • Bacitracin resistance mechanism:

    • Bacitracin binds to undecaprenyl pyrophosphate, preventing its recycling

    • uppP dephosphorylates undecaprenyl pyrophosphate, reducing available binding sites for bacitracin

    • Higher uppP activity correlates with increased bacitracin resistance

  • Cell wall integrity maintenance:

    • By ensuring continuous recycling of the lipid carrier, uppP maintains peptidoglycan synthesis

    • This contributes to resistance against cell wall-targeting antibiotics (β-lactams, glycopeptides)

  • Experimental approaches to study resistance contribution:

    • Create uppP knockout and overexpression strains

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics

    • Analyze growth kinetics in sub-inhibitory antibiotic concentrations

    • Perform competition assays between wild-type and uppP mutant strains in antibiotic gradients

  • Quantitative resistance assessment:

    • Measure survival rates at different antibiotic concentrations

    • Determine fitness costs of uppP mutations or overexpression

    • Analyze changes in membrane permeability and cell wall composition

Understanding uppP's role in antibiotic resistance has implications for developing strategies to enhance antibiotic efficacy against Pseudomonas species.

How can recombinant Pseudomonas putida uppP be used in synthetic biology applications?

Recombinant Pseudomonas putida uppP offers several valuable applications in synthetic biology:

  • Engineering cell wall biosynthesis pathways:

    • Modulate uppP expression to optimize peptidoglycan synthesis rates

    • Engineer strains with altered cell wall properties for specialized applications

    • Create conditional expression systems for controlled cell wall remodeling

  • Biotechnological applications in P. putida chassis organisms:

    • P. putida has emerged as a versatile microbial chassis for diverse biotechnological applications

    • Manipulating uppP can enhance the strain's tolerance to toxic compounds by modifying cell envelope properties

    • Integration with existing P. putida metabolic engineering strategies for natural product synthesis

  • Methodological approaches:

    • Apply synthetic promoters with varying strengths to tune uppP expression

    • Utilize inducible systems for temporal control of uppP activity

    • Create fusion proteins with fluorescent tags for subcellular localization studies

    • Integrate uppP modules into larger synthetic pathways

  • Potential applications:

    • Engineering strains for enhanced tolerance to organic solvents

    • Creating stress-responsive cell wall modification systems

    • Developing biosensors based on cell wall integrity pathways

These applications leverage P. putida's intrinsic metabolic versatility and xenobiotic tolerance, making it an excellent platform for synthetic biology applications involving membrane and cell wall engineering .

What are the current challenges in crystallizing Pseudomonas putida uppP for structural studies?

Crystallizing membrane proteins like Pseudomonas putida uppP presents several methodological challenges that researchers must address:

  • Membrane protein-specific obstacles:

    • Hydrophobic transmembrane domains prone to aggregation

    • Conformational heterogeneity affecting crystal packing

    • Detergent micelles necessary for solubilization but interfering with crystal contacts

    • Limited exposed hydrophilic surfaces for crystal contact formation

  • Methodological approaches to overcome challenges:

    • Protein engineering strategies:

      • Truncation of flexible termini

      • Creation of fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

      • Surface entropy reduction through mutagenesis of flexible, charged residues

    • Crystallization techniques:

      • Lipidic cubic phase (LCP) crystallization

      • Bicelle-based crystallization

      • Antibody fragment co-crystallization to increase hydrophilic surface area

  • Alternative structural approaches:

    • Cryo-electron microscopy for single-particle analysis

    • Solid-state NMR for membrane proteins in native-like lipid environments

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and accessibility studies

  • Detergent screening strategy:

Detergent ClassExamplesAdvantagesDisadvantages
MaltosidesDDM, DMMild, maintain activityLarge micelles
GlucosidesOG, NGSmaller micellesMore denaturing
Neopentyl glycolsLMNG, MNG-3Stability, small micellesExpensive
Facial amphiphilesFA-3Novel crystal contactsLimited availability

Success in crystallizing uppP would provide critical insights into its catalytic mechanism and substrate specificity, potentially enabling structure-based inhibitor design.

How can I resolve expression and purification issues with recombinant Pseudomonas putida uppP?

Researchers encountering difficulties with uppP expression and purification should implement a systematic troubleshooting approach:

  • Expression optimization strategies:

    • Construct design considerations:

      • Include N-terminal signal sequence for proper membrane targeting

      • Add affinity tags (His6, FLAG) with flexible linkers

      • Consider fusion partners to enhance solubility

    • Expression condition optimization:

      • Reduce induction temperature (16-25°C) to slow expression rate

      • Test various induction levels (IPTG concentrations or promoter strengths)

      • Evaluate different growth media formulations

      • Consider co-expression with chaperones

  • Membrane protein solubilization approach:

    • Methodical detergent screening:

      • Start with mild detergents (DDM, LMNG)

      • Test detergent concentration, pH, and ionic strength

      • Consider detergent mixtures for improved extraction

    • Alternative solubilization strategies:

      • Amphipol-based extraction

      • Styrene-maleic acid copolymer (SMA) for native nanodiscs

      • Cell-free expression directly into nanodiscs or liposomes

  • Purification troubleshooting matrix:

IssuePotential CausesSolutionsVerification Method
Low yieldPoor expression, inefficient extractionOptimize induction, test different detergentsWestern blot, activity assay
Multiple bandsProteolysis, aggregationAdd protease inhibitors, optimize bufferSDS-PAGE, mass spectrometry
No activityDenaturation, cofactor lossInclude stabilizing agents, add cofactorsActivity assays with controls
AggregationDetergent exchange, concentrationOptimize detergent CMC ratios, add glycerolSize exclusion chromatography
  • Quality control approaches:

    • Circular dichroism to verify secondary structure

    • Fluorescence spectroscopy for tertiary structure assessment

    • Thermal shift assays for stability analysis

    • Activity assays to confirm functional state

These methodological approaches can help overcome common challenges associated with membrane protein expression and purification.

How can I troubleshoot contradictory results in Pseudomonas putida uppP functional studies?

When faced with contradictory results in uppP functional studies, researchers should implement a systematic approach to identify and resolve discrepancies:

  • Methodological validation:

    • Enzyme activity assay verification:

      • Compare multiple assay methods (colorimetric, radioactive)

      • Validate linearity, sensitivity, and reproducibility

      • Include positive and negative controls

    • Expression system comparison:

      • Test activity in different expression hosts

      • Compare membrane vs. detergent-solubilized preparations

      • Evaluate effects of different affinity tags and fusion partners

  • Experimental design analysis:

    • Evaluate statistical power and sample size sufficiency

    • Identify potential confounding variables

    • Implement blinded experimental protocols where applicable

    • Consider between-subjects vs. within-subjects design implications

  • Biological interpretation framework:

    • Consider strain-specific variations in Pseudomonas putida

    • Evaluate potential post-translational modifications

    • Assess impact of growth conditions on enzyme regulation

    • Investigate potential interaction partners affecting activity

  • Discrepancy resolution approach:

    • Design decisive experiments targeting specific contradictions

    • Implement orthogonal methods to verify key findings

    • Conduct collaborative cross-laboratory validation

    • Perform meta-analysis of conflicting results

What non-traditional methods can be used to study Pseudomonas putida uppP in its native membrane environment?

Researchers seeking to study uppP in native-like conditions can employ several innovative methodological approaches:

  • Advanced microscopy techniques:

    • Super-resolution microscopy:

      • Photoactivated localization microscopy (PALM) for single-molecule tracking

      • Stimulated emission depletion (STED) microscopy for nanoscale localization

      • Design: Fuse uppP with photoconvertible fluorescent proteins

    • Atomic force microscopy (AFM):

      • High-resolution topography of membrane proteins

      • Single-molecule force spectroscopy for protein-substrate interactions

      • Design: Prepare native membrane patches on mica surfaces

  • Native membrane isolation approaches:

    • Styrene-maleic acid lipid particles (SMALPs) extraction

    • Native nanodiscs formation

    • Spheroplast preparation for patch-clamp studies

    • Membrane vesicle isolation with right-side-out or inside-out orientation

  • In situ activity measurement techniques:

    • Enzyme activity in native membranes:

      • Continuous monitoring of phosphate release in membrane fractions

      • Substrate accessibility assays with membrane-impermeant reagents

      • Design: Compare activity in various membrane preparations vs. detergent-solubilized enzyme

  • Genetic approaches for in vivo study:

    • Conditional depletion systems (degradation tags, antisense RNA)

    • CRISPR interference for gene regulation

    • Fluorescent biosensors for real-time activity monitoring

    • Genetic suppressor analysis to identify functional interactions

These methodological approaches enable researchers to study uppP function while maintaining its native membrane environment, providing insights that might be missed in traditional purified protein studies.

How can I develop assays to screen for Pseudomonas putida uppP inhibitors?

To develop effective screening assays for uppP inhibitors, researchers should implement a multi-tiered approach:

  • Primary screening assays:

    • Phosphate release-based assays:

      • Malachite green assay for inorganic phosphate detection

      • EnzChek Phosphate Assay for continuous monitoring

      • Design: Optimize enzyme concentration, substrate levels, and reaction time for Z' > 0.7

    • Fluorescence-based approaches:

      • FRET-based substrate analogs for real-time monitoring

      • Environment-sensitive fluorescent probes for detecting conformational changes

      • Design: Develop robust positive/negative controls and validate with known phosphatase inhibitors

  • Secondary confirmation assays:

    • Radiometric assays using ³²P-labeled substrates

    • Surface plasmon resonance for direct binding analysis

    • Thermal shift assays to detect stabilizing interactions

    • Isothermal titration calorimetry for binding thermodynamics

  • Cellular validation approaches:

    • Whole-cell bacitracin susceptibility:

      • Measure growth inhibition in the presence of bacitracin ± test compounds

      • Checkerboard assays for synergy between bacitracin and inhibitors

      • Design: Compare effects in wild-type vs. uppP overexpression strains

  • Assay optimization strategy:

Assay ParameterOptimization ApproachValidation Method
Enzyme concentrationTitration to determine linear rangeActivity vs. [enzyme] plot
Substrate concentrationKinetic analysis (Km determination)Lineweaver-Burk plots
Buffer compositionpH, ionic strength screeningActivity stability testing
Detergent concentrationMinimal effective concentrationActivity retention assay
DMSO toleranceIncreasing DMSO % vs. activityZ' determination at each DMSO %

These methodological approaches provide a comprehensive framework for identifying, validating, and characterizing potential inhibitors of Pseudomonas putida uppP, which could have applications in antimicrobial development.

What are emerging approaches for studying the role of Pseudomonas putida uppP in bacterial stress responses?

Cutting-edge methodological approaches for investigating uppP's role in stress responses include:

  • Systems biology approaches:

    • Transcriptomic profiling:

      • RNA-seq to analyze uppP expression under various stress conditions

      • Design: Compare wild-type vs. uppP mutant responses to cell wall stressors

    • Metabolomic analysis:

      • Quantify undecaprenyl-related metabolites during stress responses

      • Design: Develop targeted LC-MS/MS methods for lipid carrier cycle intermediates

  • Synthetic biology strategies:

    • Engineer tunable uppP expression systems with varying promoter strengths

    • Create reporter fusions to monitor uppP regulation in real-time

    • Develop synthetic stress-responsive circuits incorporating uppP

    • Design: Utilize P. putida's versatile metabolism and stress tolerance capabilities

  • Advanced genetic approaches:

    • CRISPR-based methods:

      • CRISPRi for fine-tuned repression of uppP

      • Base editors for generating point mutations without selection

      • Design: Create libraries of uppP variants with altered regulatory properties

    • Transposon sequencing (Tn-seq):

      • Identify genetic interactions with uppP under stress conditions

      • Design: Compare fitness effects of genome-wide mutations in uppP+ vs. uppP- backgrounds

  • Single-cell techniques:

    • Microfluidic devices for analyzing heterogeneity in stress responses

    • Single-cell transcriptomics to identify subpopulations with distinct uppP regulation

    • Time-lapse microscopy with fluorescent reporters

These emerging approaches will provide deeper insights into how uppP functions within the complex stress response networks of Pseudomonas putida, potentially revealing new roles beyond its canonical function in cell wall biosynthesis.

How can participation in Pseudomonas putida uppP research be facilitated for non-traditional researchers?

For non-traditional researchers interested in participating in uppP research, several methodological approaches can facilitate involvement:

  • Collaborative research structures:

    • Academic-community partnerships:

      • Establish remote research opportunities with defined projects

      • Develop mentorship programs pairing experienced researchers with newcomers

      • Design: Focus on specific, well-defined aspects of uppP research suitable for remote participation

    • Distributed research networks:

      • Create standardized protocols for uppP research that can be implemented across diverse settings

      • Establish data sharing platforms for collaborative analysis

      • Design: Implement quality control metrics to ensure consistent results across participants

  • Skill development pathways:

    • Online training in key techniques (molecular biology, protein biochemistry)

    • Virtual laboratory simulations for experimental design practice

    • Modular learning approaches focusing on specific aspects of uppP research

    • Design: Structure learning to build competence progressively from basic to advanced techniques

  • Access to research resources:

    • Material transfer agreements for sharing research materials

    • Cloud-based computational resources for data analysis

    • Shared access to specialized equipment through core facilities

    • Design: Develop protocols specifically adapted for resource-limited settings

  • Involvement opportunities for non-traditional researchers:

Research AspectEntry PointsRequired ResourcesExpected Outcomes
Computational analysisSequence analysis, structural predictionComputer, internet accessIdentification of conserved motifs, mutation effects
Literature synthesisSystematic reviews on specific uppP aspectsDatabase accessComprehensive knowledge synthesis, research gap identification
Protocol developmentOptimization of uppP assays for different settingsBasic laboratory equipmentStandardized methods accessible to diverse researchers
Data analysisStatistical evaluation of published resultsStatistical softwareMeta-analyses, novel insights from existing data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.