Recombinant Pseudomonas putida UPF0114 protein PputW619_4503 (PputW619_4503)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PputW619_4503; UPF0114 protein PputW619_4503
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Pseudomonas putida (strain W619)
Target Names
PputW619_4503
Target Protein Sequence
MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVIHVLPNVFALSEADLILVILSL IDMSLVGGLLVMVMISGYENFVSQLDIDDSKEKLNWLGKMDSSSLKMKVAASIVAISSIH LLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKVTKH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the structural characteristics of UPF0114 family proteins?

UPF0114 family proteins, including PputW619_4503, are characterized by:

  • Predominantly alpha-helical secondary structures

  • Multiple hydrophobic regions consistent with membrane localization

  • Conserved domains that may be involved in protein-protein interactions or small molecule binding

Analysis of the amino acid sequence reveals multiple transmembrane domains, suggesting integration into bacterial membranes. The protein contains conserved regions typical of the UPF0114 family, though the specific function remains under investigation. Structural predictions indicate potential binding sites that may interact with hydrocarbon substrates, which aligns with P. putida's known capabilities in degrading aromatic compounds .

How should I reconstitute and store recombinant PputW619_4503?

For optimal stability and activity:

  • Reconstitution: Centrifuge the vial briefly before opening. Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Storage preparation: Add glycerol to a final concentration of 50% (acceptable range: 5-50%) and aliquot for long-term storage to prevent repeated freeze-thaw cycles.

  • Storage conditions: Store at -20°C/-80°C for long-term storage. Working aliquots can be stored at 4°C for up to one week.

  • Buffer conditions: The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0.

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. Working aliquots should be prepared during initial reconstitution to minimize degradation .

What expression systems are optimal for studying PputW619_4503?

The choice of expression system depends on research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coli (standard)High yield, cost-effective, rapid growthPotential folding issues with membrane proteinsInitial characterization, abundant protein production
P. putida hostNative environment, proper foldingLower yields, more complex growth conditionsFunctional studies requiring native modifications
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited post-translational modificationsProteins toxic to host cells

For most applications, E. coli expression systems with N-terminal His tags provide sufficient yields and purity. The commercially available recombinant protein is expressed in E. coli, which appears to produce functional protein suitable for most applications .

How can I verify the quality and integrity of recombinant PputW619_4503?

Quality assessment should include multiple methods:

  • SDS-PAGE analysis: Verify size (approximately 18-20 kDa plus tag size) and purity (should exceed 90%).

  • Western blotting: Use anti-His antibodies or protein-specific antibodies if available.

  • Mass spectrometry: Confirm molecular weight and sequence coverage.

  • Circular dichroism: Assess secondary structure to ensure proper folding.

  • Dynamic light scattering: Evaluate homogeneity and detect aggregation.

For membrane-associated proteins like PputW619_4503, solubility tests in different detergents may be necessary to optimize buffer conditions and prevent aggregation. The protein's integrity directly impacts experimental outcomes, particularly in functional assays .

What purification methods are recommended for PputW619_4503?

If expressing the protein yourself rather than using commercial sources:

  • Primary purification: Nickel affinity chromatography using the His tag is most efficient (for His-tagged protein).

  • Secondary purification: Size exclusion chromatography to remove aggregates and contaminants.

  • Detergent considerations: For membrane-associated proteins, mild non-ionic detergents (0.1% DDM or 1% CHAPS) may improve solubility during purification.

  • Buffer optimization: Tris-based buffers (pH 7.5-8.0) with 150-300 mM NaCl typically yield good results.

The purification protocol may need optimization based on specific experimental requirements and downstream applications. Purity greater than 90% as determined by SDS-PAGE is generally suitable for most research applications .

How can PputW619_4503 be used in functional studies related to bacterial degradation pathways?

PputW619_4503 belongs to Pseudomonas putida, a bacterium known for its versatile metabolic capabilities, particularly in degrading various organic compounds. Functional studies might include:

  • Protein-substrate interaction assays: Investigate binding affinities with potential hydrocarbon substrates using fluorescence quenching or isothermal titration calorimetry.

  • Knockout/complementation studies: Generate knockout strains and complement with wild-type or mutant versions to assess phenotypic changes in degradation capabilities.

  • Protein localization: Use GFP fusions or immunofluorescence to determine subcellular localization, particularly in relation to degradation pathway components.

  • Transcriptomic analysis: Compare expression patterns under different growth conditions, especially in the presence of potential substrates.

Research suggests potential roles in membrane transport or signaling related to hydrocarbon metabolism, though this requires further experimental validation .

What approaches are recommended for structural studies of UPF0114 family proteins?

Structural characterization presents challenges due to the membrane-associated nature of these proteins:

  • X-ray crystallography preparation:

    • Optimize detergent screens (typically starting with DDM, LDAO, or C8E4)

    • Consider lipidic cubic phase crystallization

    • Use truncation constructs to remove flexible regions that may impede crystallization

  • NMR spectroscopy:

    • Solution NMR may be challenging due to size; consider solid-state NMR

    • Isotopic labeling (15N, 13C) is essential for structural determination

  • Cryo-electron microscopy:

    • Particularly useful for membrane protein complexes

    • May require reconstitution into nanodiscs or amphipols

  • Computational approaches:

    • Homology modeling based on structurally characterized family members

    • Molecular dynamics simulations to predict dynamic behavior in membrane environments

Successful structural characterization would significantly advance understanding of this protein family's function in bacterial metabolism and potential biotechnological applications .

How does environmental stress affect expression of PputW619_4503 and related proteins?

Pseudomonas putida is known for thriving in contaminated environments, suggesting adaptive responses to various stressors:

  • Transcriptional regulation: qPCR studies examining expression levels under different stressors (hydrocarbons, heavy metals, oxidative stress) can reveal regulatory patterns.

  • Proteomic profiling: Comparative proteomics between stressed and unstressed conditions can position PputW619_4503 within stress response networks.

  • Promoter analysis: Reporter assays using the promoter region can identify environmental signals triggering expression.

  • Stress response pathway mapping: Protein-protein interaction studies can place PputW619_4503 within known stress response pathways.

Understanding environmental regulation of this protein may provide insights into adaptation mechanisms of Pseudomonas putida in contaminated environments and potential applications in bioremediation .

Why might PputW619_4503 show inconsistent activity in experimental assays?

Several factors can contribute to inconsistent results:

  • Protein denaturation: Membrane proteins are particularly sensitive to freeze-thaw cycles. Maintain aliquots at 4°C for short-term use and avoid repeated freeze-thaw cycles.

  • Buffer incompatibility: The protein requires specific buffer conditions (Tris/PBS-based buffer, pH 8.0). Verify buffer compatibility with your assay system.

  • Co-factor requirements: Many bacterial proteins require specific co-factors that may be depleted during purification. Consider adding potential cofactors (metal ions, specific lipids) to reaction mixtures.

  • Aggregation issues: Monitor protein aggregation using dynamic light scattering or native PAGE. Optimize detergent conditions if necessary.

  • Post-translational modifications: E. coli-expressed proteins may lack native modifications present in Pseudomonas. Consider parallel experiments with protein expressed in native-like systems.

Systematic optimization of reaction conditions and proper protein handling can significantly improve consistency in experimental results .

How can I optimize protein-protein interaction studies involving PputW619_4503?

When investigating potential binding partners:

  • Cross-linking approaches:

    • Use membrane-permeable cross-linkers for in vivo studies

    • Optimize cross-linker concentration and reaction time to capture transient interactions

  • Pull-down assay optimization:

    • Include appropriate detergents to maintain solubility

    • Consider tandem affinity purification to reduce false positives

    • Validate interactions through reciprocal pull-downs

  • Surface plasmon resonance (SPR) considerations:

    • Immobilize the protein in oriented manner to preserve binding interfaces

    • Use low detergent concentrations compatible with SPR microfluidics

    • Include proper controls for non-specific binding

  • Proximity-based methods:

    • FRET/BRET approaches using fluorescent protein fusions

    • Split complementation assays (bacterial two-hybrid systems)

The membrane association of PputW619_4503 necessitates careful consideration of detergent conditions to maintain native conformation while allowing access to binding partners .

What approaches can resolve solubility issues with PputW619_4503?

Membrane-associated proteins like PputW619_4503 often present solubility challenges:

  • Detergent screening:

    DetergentConcentrationBest For
    DDM0.05-0.1%General solubilization
    CHAPS0.5-1.0%Maintaining enzymatic activity
    Triton X-1000.1%Initial extraction
    Digitonin0.5-1.0%Preserving protein-protein interactions
  • Buffer optimization:

    • Test pH range (7.0-8.5)

    • Vary salt concentration (100-500 mM NaCl)

    • Add stabilizing agents (glycerol 5-10%, trehalose 5%)

  • Fusion partner strategies:

    • Consider solubility-enhancing tags (MBP, SUMO) if expressing the protein yourself

    • Include cleavage sites for tag removal after solubilization

  • Alternative solubilization approaches:

    • Amphipols or nanodiscs for detergent-free handling

    • Reconstitution into liposomes for functional studies

Optimal solubilization conditions may vary depending on downstream applications and should be determined empirically .

How should researchers analyze sequence conservation of UPF0114 family proteins across bacterial species?

Comparative sequence analysis provides insights into functional domains and evolutionary relationships:

  • Multiple sequence alignment protocols:

    • Collect homologous sequences using BLAST against diverse bacterial genomes

    • Use MUSCLE or MAFFT aligners with parameters optimized for transmembrane proteins

    • Visualize conservation using Jalview or similar tools with Taylor coloring scheme

  • Evolutionary analysis:

    • Construct phylogenetic trees using maximum likelihood methods

    • Consider protein domain architecture in different bacterial lineages

    • Correlate sequence clusters with ecological niches of source organisms

  • Functional domain prediction:

    • Use ConSurf to map conservation onto structural models

    • Identify highly conserved residues as candidates for site-directed mutagenesis

    • Compare conservation patterns with known functional domains in related proteins

  • Statistical approaches:

    • Apply mutual information analysis to detect co-evolving residues

    • Use statistical coupling analysis to identify functional networks

What statistical methods are appropriate for analyzing functional assay data with PputW619_4503?

  • Experimental design considerations:

    • Include appropriate technical replicates (minimum n=3)

    • Perform biological replicates with independently prepared protein batches

    • Include positive and negative controls in each experiment

  • Data normalization approaches:

    • Normalize to protein concentration determined by Bradford or BCA assay

    • Consider activity ratios relative to well-characterized reference reactions

    • Account for background activity in control reactions

  • Statistical test selection:

    • For comparing two conditions: t-test (parametric) or Mann-Whitney (non-parametric)

    • For multiple conditions: ANOVA with appropriate post-hoc tests (Tukey or Dunnett)

    • For dose-response relationships: regression analysis and EC50 calculation

  • Data visualization:

    • Present individual data points alongside means and error bars

    • Use box plots to show distribution characteristics

    • Consider heatmaps for multifactorial experiments

How can contradictory results in PputW619_4503 research be reconciled?

When faced with conflicting experimental outcomes:

  • Systematic methodology comparison:

    • Create a detailed table comparing experimental conditions across studies

    • Identify variables that differ between protocols (buffer composition, protein source, detection methods)

    • Perform controlled experiments testing each variable independently

  • Protein batch characterization:

    • Verify protein identity by mass spectrometry

    • Assess activity of different preparations using standardized assays

    • Check for post-translational modifications or truncations

  • Environmental factors consideration:

    • Document temperature, pH, and ionic strength during experiments

    • Consider equipment calibration differences between laboratories

    • Evaluate reagent sources and lot numbers

  • Collaborative resolution approaches:

    • Design split-laboratory validation experiments

    • Establish standardized protocols through research community consensus

    • Share materials to eliminate source variability

Scientific progress often emerges from resolving apparent contradictions, which can reveal previously unrecognized factors affecting protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.