Recombinant Pseudomonas putida Xylene monooxygenase subunit 1 (xylM)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pseudomonas putida Xylene monooxygenase subunit 1 (XylM) is a key enzyme encoded by the xylM gene, part of the TOL plasmid pWW0 in P. putida mt-2. This enzyme catalyzes the initial hydroxylation of toluene and xylenes, enabling their biodegradation into less toxic derivatives. Recombinant forms of XylM are engineered for heterologous expression in hosts like Escherichia coli or optimized P. putida strains, facilitating biocatalytic applications and bioremediation studies .

Catalytic Mechanism and Substrate Specificity

Multi-Step Oxidation:
XylM catalyzes three sequential monooxygenation steps:

  1. Toluene → Benzyl alcohol

  2. Benzyl alcohol → Benzaldehyde

  3. Benzaldehyde → Benzoic acid .

Substrate Inhibition:

  • Unoxidized substrates (e.g., toluene) inhibit later oxidation steps (e.g., aldehyde → acid) .

  • Alcohol intermediates (e.g., benzyl alcohol) competitively inhibit aldehyde oxidation .

Kinetic Parameters:

SubstrateReaction StepApparent K<sub>m</sub> (µM)Max Activity (U/g CDW)
TolueneHydroxylation12 ± 240 ± 5
3,4-DimethylbenzaldehydeAldehyde oxidation55 ± 7120 ± 10
Data derived from whole-cell assays in E. coli JM101(pSPZ3) .

Host Systems and Recombinant Expression

Comparison of Host Strains:

Host StrainXMO Activity (U/g CDW)Aldehyde Dehydrogenase ActivityAromatic Amine Inhibition
E. coli JM10140 ± 5High (reduces aldehydes)Significant
P. putida DOT-T1E85 ± 8Oxidizes aldehydes to acidsLow
P. putida PpS8178 ± 6ModerateMinimal
Adapted from Meyer et al. (2005) .

Key Challenges:

  • E. coli produces host-intrinsic dehydrogenases that reduce aldehydes to alcohols, counteracting XylM activity .

  • Aromatic amines generated by nitro-group reduction in E. coli reversibly inhibit XylM .

Applications in Biocatalysis and Bioremediation

Chemical Synthesis:

  • XylM enables selective oxidation of methyl groups in aromatic compounds (e.g., m-nitrotoluene → m-nitrobenzoic acid) .

  • Recombinant P. putida strains achieve 720 mg/L mono-rhamnolipids using XylM-driven pathways .

Bioremediation:

  • xylM expression in soil is nitrogen-regulated; nitrate (NO<sub>3</sub><sup>−</sup>) enhances m-xylene mineralization compared to ammonium (NH<sub>4</sub><sup>+</sup>) .

  • Engineered P. putida strains degrade xylene 1.7× faster in NO<sub>3</sub><sup>−</sup>-amended soils .

Optimization Strategies

Host Engineering:

  • Deleting competing pathways (e.g., polyhydroxyalkanoate synthesis) improves product yields .

  • Adaptive laboratory evolution (ALE) reduces lag phases in xylose-grown P. putida by 50% .

Regulatory Tweaks:

  • Constitutive promoters (e.g., P<sub>EM7</sub>) enhance xylE transporter expression, boosting substrate uptake .

Future Directions

  • Structural resolution of XylM to guide rational engineering.

  • Integration with lignin valorization pathways for sustainable chemical production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
xylM; Xylene monooxygenase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Pseudomonas putida (Arthrobacter siderocapsulatus)
Target Names
xylM
Target Protein Sequence
MDTLRYYLIPVVTACGLIGFYYGGYWVWLGAATFPALMVLDVILPKDFSARKVSPFFADL TQYLQLPLMIGLYGLLVFGVENGRIELSEPLQVAGCILSLAWLSGVPTLPVSHELMHRRH WLPRKMAQLLAMFYGDPNRDIAHVNTHHLYLDTPLDSDTPYRGQTIYSFVISATVGSVKD AIKIEAETLRRKGQSPWNLSNKTYQYVALLLALPGLVSYLGGPALGLVTIASMIIAKGIV EGFNYFQHYGLVRDLDQPILLHHAWNHMGTIVRPLGCEITNHINHHIDGYTRFYELRPEK EAPQMPSLFVCFLLGLIPPLWFALIAKPKLRDWDQRYATPGERELAMAANKKAGWPLWCE SELGRVASI
Uniprot No.

Target Background

Function
This enzyme oxidizes toluene and xylenes to their corresponding (methyl)benzyl alcohols. Exhibiting broad substrate specificity, it also oxidizes (methyl)benzyl alcohols to (methyl)benzaldehydes and converts indole to indoxyl.
Protein Families
Fatty acid desaturase type 1 family, AlkB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of xylene monooxygenase subunit 1 (xylM) in Pseudomonas putida?

Xylene monooxygenase subunit 1 (xylM) is a crucial component of the XMO enzyme complex in Pseudomonas putida, serving as the hydroxylase component responsible for substrate recognition and binding. It works in conjunction with other subunits to catalyze the initial oxidation step in the biodegradation pathway of aromatic compounds such as toluene and xylene isomers. The enzyme functions by introducing an oxygen atom into the aromatic ring or methyl group, preparing these compounds for further degradation by other enzymes in the metabolic pathway. Studies have shown that xylM contains the active site where the substrate binding occurs, while it partners with xylA (reductase component) to form a complete functional enzyme complex capable of electron transfer necessary for the oxygenation reaction. Together with host cell enzymes, xylM participates in multiple sequential oxidation reactions, as demonstrated in studies with m-nitrotoluene where this compound was consecutively oxygenated to m-nitrobenzyl alcohol, m-nitrobenzaldehyde, and m-nitrobenzoic acid .

How should researchers design experiments to optimize recombinant xylM expression levels?

Experimental design for optimizing recombinant xylM expression should employ multivariate statistical approaches rather than traditional univariate methods to efficiently identify optimal conditions. A fractional factorial design can be implemented to simultaneously evaluate multiple variables including medium composition (carbon source, nitrogen source, trace elements), induction parameters (inducer concentration, induction time, temperature), and cultivation conditions (pH, dissolved oxygen, agitation) . This approach allows for the identification of not only individual variable effects but also interaction effects that might be missed in one-factor-at-a-time experiments. For xylM expression, researchers should consider evaluating 8-10 key variables at two levels (high and low) with center point replicates to assess experimental variability and detect potential non-linear effects . Expression time should be carefully optimized, as studies with other recombinant proteins have shown that extended induction periods beyond 6 hours can reduce productivity, while periods between 4-6 hours often yield optimal results . Analysis of the experimental data should include response surface methodology to model the relationship between variables and to identify conditions that maximize xylM expression while maintaining proper folding and functionality.

What strategies can overcome the inhibitory effects of aromatic amines on XMO activity?

Overcoming the inhibitory effects of aromatic amines on XMO activity requires multiple strategies addressing both the formation of these inhibitors and their impact on enzyme function. Studies have demonstrated that host-intrinsic oxidoreductases can reduce nitro groups on substrates like m-nitrotoluene, resulting in aromatic amines that reversibly inhibit XMO activity . One effective approach is the selection of alternative host organisms with reduced nitro-reducing activity, as P. putida strains have been shown to produce significantly lower levels of XMO-inhibiting aromatic amines compared to E. coli JM101 . For researchers continuing to use E. coli expression systems, genetic modification to knock out or downregulate the genes encoding the problematic oxidoreductases could minimize inhibitor formation. Additionally, process engineering strategies such as in situ product removal, fed-batch feeding of substrate at controlled rates to minimize inhibitor accumulation, or two-phase reaction systems to partition inhibitory compounds away from the enzyme can be implemented. Protein engineering approaches targeting the xylM substrate binding site to reduce its affinity for aromatic amines while maintaining activity toward the desired substrates represents another advanced strategy for researchers familiar with protein structure-function relationships.

What are the optimal analytical methods for monitoring xylM-catalyzed reactions?

The selection of analytical methods for monitoring xylM-catalyzed reactions depends on the substrate, expected products, and specific research objectives. For reactions involving aromatic compounds such as m-nitrotoluene, HPLC with UV detection provides effective separation and quantification of substrates, intermediates, and products including m-nitrobenzyl alcohol, m-nitrobenzaldehyde, and m-nitrobenzoic acid . GC-MS offers excellent sensitivity and specificity for volatile compounds, allowing for the identification of unexpected side products that may form due to interactions with host enzymes. For real-time monitoring of reaction progress, spectrophotometric methods targeting the consumption of NAD(P)H cofactors or oxygen uptake can provide continuous data, though these may lack specificity in complex reaction mixtures. When investigating novel substrates or reaction conditions, a combination of analytical techniques is recommended to fully characterize the reaction profile and identify potential interfering reactions. Researchers should also consider developing specific activity assays based on colorimetric or fluorometric detection of product formation, which can simplify routine activity measurements and high-throughput screening of mutant libraries.

How can xylM be engineered for enhanced stability and substrate specificity?

Engineering xylM for enhanced stability and altered substrate specificity requires a combination of structural knowledge and directed evolution approaches. Site-directed mutagenesis targeting residues in the substrate-binding pocket can alter specificity, while mutations at the subunit interface may enhance stability of the complex. Based on homology with related monooxygenases, researchers can identify conserved catalytic residues and substrate-interacting regions as targets for rational design approaches . For stability enhancement, computational methods identifying regions of high flexibility or susceptibility to denaturation can guide the introduction of stabilizing interactions such as salt bridges or disulfide bonds. A comprehensive directed evolution approach would involve creating libraries through error-prone PCR or DNA shuffling, followed by high-throughput screening for desired properties such as activity toward novel substrates or stability under elevated temperatures or organic solvents. The screening system should be carefully designed to efficiently identify improvements in the desired properties, possibly using colorimetric assays for product formation or stability tests under challenging conditions. Successful engineering examples from related enzymes suggest that combinations of targeted mutations at the active site with stabilizing mutations in scaffold regions often yield the most significant improvements in both specificity and stability.

What are the kinetic parameters of xylM-catalyzed reactions with different substrates?

The kinetic parameters of xylM-catalyzed reactions vary significantly depending on the substrate structure and reaction conditions. For the model substrate m-nitrotoluene, the enzyme demonstrates sequential oxidation kinetics, with initial hydroxylation of the methyl group followed by further oxidation to aldehyde and carboxylic acid derivatives . A comprehensive kinetic analysis should include determination of Km, kcat, and kcat/Km values for each substrate to assess both binding affinity and catalytic efficiency. The table below summarizes typical kinetic parameters for XMO with various substrates based on available research data:

SubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Products Formed
Toluene5-150.5-2.01×10⁵-5×10⁵Benzyl alcohol, Benzaldehyde
m-Xylene3-101.0-3.02×10⁵-8×10⁵3-Methylbenzyl alcohol
m-Nitrotoluene20-500.2-0.80.5×10⁴-2×10⁴m-Nitrobenzyl alcohol, m-Nitrobenzaldehyde

When determining kinetic parameters, researchers should account for potential complications including substrate inhibition at high concentrations, product inhibition effects, and competing reactions from host enzymes . Oxygen concentration must also be carefully controlled as it serves as a co-substrate in the reaction and can become limiting under standard laboratory conditions. Additionally, the stability of xylM during the course of kinetic experiments should be verified, as activity loss over time can lead to underestimation of kinetic parameters.

What purification strategies yield the highest purity and retention of activity for recombinant xylM?

Purification of recombinant xylM requires careful consideration of protein stability, complex integrity, and removal of contaminating proteins while maintaining enzymatic activity. A successful purification strategy typically begins with optimizing cell lysis conditions, testing various buffer systems to identify those that maintain protein solubility and stability. Affinity chromatography using His-tag or other fusion tags provides an effective initial capture step, though care must be taken to ensure the tag does not interfere with enzyme activity or complex formation. For xylM specifically, purification under mild conditions is critical as the enzyme contains multiple domains and interfaces that can be disrupted by harsh conditions. Ion exchange chromatography can be employed as a secondary purification step, particularly if the isoelectric point of xylM differs significantly from major contaminants. Size exclusion chromatography serves as an excellent polishing step and also provides information about the oligomeric state of the purified protein, which is important for confirming proper complex formation. Throughout the purification process, samples should be analyzed for both protein purity (SDS-PAGE, Western blot) and enzymatic activity to calculate specific activity and recovery yields at each step, with typical purification tables including:

Purification StepTotal Protein (mg)Total Activity (U)Specific Activity (U/mg)Purification FactorYield (%)
Crude Extract1000500051100
Affinity Chromatography150375025575
Ion Exchange502500501050
Size Exclusion251750701435

Addition of stabilizing agents such as glycerol, reducing agents, or specific cofactors may be necessary throughout the purification process to maintain enzyme stability, with optimal conditions determined through systematic testing.

How can researchers overcome solubility issues in recombinant xylM expression?

Overcoming solubility issues in recombinant xylM expression requires a multifaceted approach addressing protein folding, expression conditions, and potential fusion partners. Temperature modulation is one of the most effective strategies, with lower induction temperatures (15-25°C) often promoting proper folding by slowing translation and allowing chaperones to assist in the folding process . Inducer concentration optimization is equally important, as high inducer levels can lead to rapid protein accumulation that overwhelms the cell's folding machinery. A systematic experimental design approach evaluating multiple variables simultaneously can efficiently identify optimal conditions for soluble expression, with fractional factorial designs allowing researchers to test numerous parameters with minimal experiments . Fusion tags such as MBP (maltose-binding protein), TrxA (thioredoxin), or SUMO can dramatically enhance solubility of difficult proteins, though careful evaluation of tag removal options and effects on activity is necessary. Co-expression of molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can significantly improve soluble yields by providing folding assistance for complex multi-domain proteins like xylM. For proteins that remain challenging, specialized expression hosts with distinct physiological properties can be explored, as P. putida strains have demonstrated advantages over E. coli for XMO expression . Culture media composition also plays a critical role, with enriched media containing additional amino acids and vitamins often promoting higher soluble protein yields compared to minimal media.

How can researchers address issues of enzyme instability during xylM-catalyzed reactions?

Addressing enzyme instability during xylM-catalyzed reactions requires identification of the specific degradation mechanisms and implementation of appropriate stabilization strategies. Oxidative damage is a common issue for monooxygenases like XMO due to the formation of reactive oxygen species during catalysis, particularly when uncoupling occurs. Addition of catalase or superoxide dismutase to reaction mixtures can mitigate oxidative damage by removing hydrogen peroxide and superoxide radicals that may form during the reaction cycle. Substrate or product inhibition can lead to apparent instability, which can be addressed through reaction engineering approaches such as fed-batch substrate addition or in situ product removal using adsorbents or extraction. Temperature and pH stability profiles should be established to ensure reaction conditions remain within the enzyme's stability range, with potential stabilization through immobilization on solid supports that can restrict protein unfolding. For reactions involving organic solvents or co-solvents necessary for substrate solubility, systematic testing of various solvent types and concentrations can identify conditions that balance substrate solubility with enzyme stability. Addition of stabilizing agents such as glycerol, trehalose, or bovine serum albumin can provide general protective effects against various denaturation pathways. For advanced applications requiring extended reaction times, enzyme engineering approaches targeting surface residues exposed to solvent or interface regions between subunits can significantly enhance operational stability.

What strategies can resolve inconsistent or contradictory data in xylM research?

Resolving inconsistent or contradictory data in xylM research requires systematic investigation of experimental variables and potential sources of error. Enzyme heterogeneity is a common source of inconsistency, particularly with multi-subunit complexes like XMO where incomplete assembly or variable stoichiometry can result in preparation-to-preparation variability. Standardization of expression and purification protocols, including rigorous quality control testing of each preparation, can reduce this variability. Assay conditions including buffer composition, pH, temperature, and the presence of stabilizing agents should be precisely controlled and reported to enable proper comparison between studies. Substrate purity and standardization are critical, as commercial sources may contain impurities that affect enzyme activity or confound analytical measurements. When contradictory results are observed between different laboratories, collaborative cross-validation studies using identical materials and protocols can help identify laboratory-specific variables affecting outcomes. For complex reaction systems involving multiple enzymes or reaction steps, the development of mathematical models incorporating all relevant reactions and equilibria can help resolve apparently contradictory observations by accounting for the influence of competing reactions or pathway interactions. Detailed time-course studies rather than single-point measurements can provide mechanistic insights that explain apparently contradictory endpoint results. When publishing research on xylM, comprehensive reporting of all experimental conditions, enzyme preparation methods, and analytical procedures is essential to enable proper interpretation and reproducibility.

What are the emerging applications of engineered xylM in biocatalysis?

Engineered xylM variants hold significant promise for expanding the scope of biocatalytic applications beyond natural substrates. Selective hydroxylation of aromatic compounds represents one of the most challenging transformations in synthetic chemistry, and engineered xylM could provide environmentally friendly alternatives to traditional metal catalysts and harsh oxidizing agents. Protein engineering approaches targeting the substrate binding pocket could generate variants capable of accepting pharmaceutical intermediates, enabling green chemistry approaches to drug synthesis. The regioselectivity of xylM could be harnessed for late-stage functionalization of complex molecules, a particularly valuable capability in medicinal chemistry where selective modification of specific positions in complex scaffolds is often required. Integration of engineered xylM into multi-enzyme cascades represents another frontier, where the product of xylM catalysis becomes the substrate for subsequent enzymatic transformations, enabling complex chemical transformations in one-pot systems without isolation of intermediates. For environmental applications, engineered xylM variants with enhanced activity toward pollutants could improve bioremediation processes targeting aromatic contaminants. The combination of directed evolution with computational design approaches is accelerating the development of highly specialized xylM variants with precisely tuned substrate specificity and enhanced stability under process conditions. As structural information about xylM and related monooxygenases continues to expand, increasingly rational approaches to enzyme engineering will become feasible, enabling the creation of biocatalysts with properties tailored to specific synthetic challenges.

What novel methodologies are being developed for high-throughput screening of xylM variants?

Novel high-throughput screening methodologies for xylM variants are critical for accelerating enzyme engineering efforts beyond traditional low-throughput activity assays. Microfluidic droplet-based platforms represent a frontier technology, encapsulating individual cells expressing xylM variants in picoliter droplets containing fluorogenic substrates that generate detectable signals upon enzymatic conversion. This approach enables screening rates of thousands to millions of variants per day while dramatically reducing reagent consumption. Cell-surface display methods, where xylM variants are expressed on the cell surface and accessible to substrates, can be coupled with fluorescence-activated cell sorting for rapid isolation of improved variants based on fluorescent product formation or binding of mechanism-based probes. Biosensor systems utilizing transcription factors that respond to xylM products can convert enzymatic activity into easily detectable signals such as fluorescent protein expression, enabling whole-cell screening formats compatible with colony or microtiter plate-based selections. Mass spectrometry-based screening approaches are increasingly feasible with advances in automated sample handling and data analysis, allowing direct detection of products without requiring fluorescent or chromogenic substrates. Computational pre-screening using machine learning algorithms trained on existing xylM sequence-function data can prioritize promising variants before experimental testing, significantly reducing the experimental burden. For specific applications requiring properties beyond simple activity measurements, specialized screening approaches might assess stability under elevated temperatures, organic solvent tolerance, or oxygen affinity through carefully designed selection pressures. The integration of multiple screening technologies into workflow pipelines allows researchers to rapidly evolve xylM variants with desired combinations of properties through iterative rounds of diversification and selection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.