Recombinant Pseudomonas stutzeri ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; PST_4197; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
atpB
Target Protein Sequence
MASTPAEYIQHHLQNLTYGKLPAGYERADGSILDQATWTIAQTGAEARDMGFMAVHLDTL GWSLLMGAIFILLFRSAAKAATAGVPGKLQNLVEMCVEFVEGVVKDTFHGRNPLIAPLAL TIFVWVFLMNSLKWIPVDYIPGIAHLLGLPAFKIVPTADPNGTFGLSLGVFILILFYSFK VKGFGGFTKELAFTPFNHWSLVPFNLFLEILGLLTKPLSLALRLFGNMYAGEVVFILIAL LPFYVQWTLNVPWAIFHILVIPLQAFIFMVLTVVYLSSAHEDHGHAELTP
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a critical role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant P. stutzeri atpB?

The most successful expression system for recombinant P. stutzeri atpB is E. coli, as evidenced by commercially available preparations of this protein. For optimal expression in E. coli, consider the following methodological approach:

  • Vector selection: Use a vector with an inducible promoter (such as T7 or tac) that allows controlled expression.

  • Host strain optimization: BL21(DE3) or C41(DE3)/C43(DE3) strains are preferable for membrane proteins like atpB.

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations can improve proper folding.

  • Tagging strategy: An N-terminal His-tag is commonly used, as seen in the commercial preparation, facilitating purification while preserving functionality .

Due to the hydrophobic nature of atpB, expression levels may be lower than soluble proteins. A systematic optimization of induction conditions (IPTG concentration, temperature, and duration) is recommended for maximum yield of properly folded protein.

What are the recommended storage and handling protocols for recombinant P. stutzeri atpB?

Based on established protocols for similar membrane proteins and commercial recommendations, the following storage and handling guidelines should be followed:

  • Short-term storage: Keep working aliquots at 4°C for up to one week to minimize freeze-thaw damage .

  • Long-term storage: Store at -20°C or preferably -80°C in small aliquots to avoid repeated freeze-thaw cycles .

  • Buffer composition: Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for optimal stability .

  • Reconstitution procedure:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for cryoprotection during storage

For biochemical studies, it's advisable to incorporate the purified protein into liposomes or nanodiscs to maintain its native conformation and functionality, as membrane proteins typically require a lipid environment for stability.

What experimental approaches can be used to study P. stutzeri atpB interactions with other ATP synthase subunits?

To investigate the interaction between P. stutzeri atpB and other ATP synthase subunits, researchers can employ several complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against the His-tag of recombinant atpB to pull down interaction partners

    • Analyze co-precipitated proteins by mass spectrometry

    • Confirm specific interactions with Western blotting

  • Crosslinking coupled with mass spectrometry:

    • Apply chemical crosslinkers (e.g., DSS, BS3) to stabilize transient interactions

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify crosslinked peptides to map interaction interfaces

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified atpB on a sensor chip

    • Flow other purified ATP synthase subunits over the surface

    • Measure binding kinetics and affinity constants

  • Genetic approaches:

    • Create site-directed mutations in atpB

    • Analyze the impact on ATP synthase assembly and function

    • Use bacterial two-hybrid systems to confirm direct interactions

These methodologies can provide detailed information about the structural organization of the ATP synthase complex and the specific role of atpB in its assembly and function.

How can researchers investigate the membrane topology of P. stutzeri atpB?

The membrane topology of P. stutzeri atpB can be studied using a combination of computational prediction and experimental validation approaches:

  • Computational prediction:

    • Use algorithms like TMHMM, HMMTOP, or MEMSAT to predict transmembrane segments

    • Apply hydropathy plot analysis to identify hydrophobic regions

    • Predict the orientation of transmembrane helices

  • Experimental validation techniques:

    • Cysteine scanning mutagenesis and accessibility studies:

      • Replace selected residues with cysteine

      • Test accessibility to membrane-impermeable sulfhydryl reagents

      • Map exposed versus buried regions

    • Protease protection assays:

      • Incorporate the protein into proteoliposomes

      • Treat with proteases from one side

      • Analyze fragment patterns to determine protected regions

    • Fusion reporter systems:

      • Create fusion proteins with reporters like GFP or alkaline phosphatase

      • Determine cellular location of reporter domains

      • Map the orientation of protein segments relative to the membrane

  • Cryo-electron microscopy:

    • Purify intact ATP synthase complex containing atpB

    • Analyze by single-particle cryo-EM

    • Determine the position and orientation of atpB within the complex

These approaches provide complementary data that can be integrated to develop a comprehensive model of how atpB is arranged within the membrane and how it contributes to proton translocation.

What methods can be used for site-directed mutagenesis studies of P. stutzeri atpB to investigate structure-function relationships?

Site-directed mutagenesis is a powerful approach to investigate structure-function relationships in P. stutzeri atpB. A comprehensive methodology involves:

  • Selection of target residues:

    • Conserved residues identified by sequence alignment across species

    • Residues in predicted proton-conducting pathways

    • Residues at predicted interfaces with other subunits

  • Mutagenesis techniques:

    • QuikChange™ or Q5® site-directed mutagenesis for single mutations

    • Gibson Assembly or Golden Gate cloning for multiple mutations

    • CRISPR-Cas9 for genomic modifications

  • Functional assays for mutant characterization:

    • In vitro reconstitution:

      • Purify mutant proteins and reconstitute into liposomes

      • Measure ATP synthesis and hydrolysis rates

      • Assess proton transport using pH-sensitive fluorescent dyes

    • In vivo complementation:

      • Express mutants in atpB-deficient strains

      • Measure growth rates on different carbon sources

      • Assess cellular ATP levels and membrane potential

  • Structural impact assessment:

    • Circular dichroism spectroscopy to evaluate secondary structure changes

    • Limited proteolysis to detect conformational alterations

    • Thermal stability assays to assess protein folding

How does recombinant P. stutzeri atpB compare with atpB from other bacterial species in terms of sequence conservation and functional implications?

Comparative analysis of P. stutzeri atpB with homologs from other bacterial species reveals important insights about evolutionary conservation and functional specialization:

SpeciesSequence Identity (%)Key Conserved MotifsNotable Differences
Escherichia coli~65-70%Arginine finger, proton channel residuesDifferences in loop regions connecting transmembrane helices
Bacillus subtilis~45-50%Core catalytic residuesMore hydrophobic residues in certain transmembrane segments
Mycobacterium tuberculosis~40-45%Proton-binding sitesExtended N-terminal region
Ralstonia eutropha~60-65%Interface residues with c-ringVariations in peripheral helices

The functional implications of these sequence differences include:

  • Species-specific adaptations:

    • Differences in optimal pH for function

    • Variations in proton-conducting pathways

    • Altered regulatory mechanisms

  • Structural considerations:

    • Conserved regions typically correspond to functionally critical domains

    • Variable regions often reflect adaptation to specific ecological niches

    • Transmembrane segments show higher conservation than loop regions

  • Evolutionary insights:

    • Core functional residues maintain high conservation across diverse bacteria

    • Peripheral residues show more variability, reflecting different environmental adaptations

    • P. stutzeri atpB contains specific residues that may be related to its unique environmental adaptations

This comparative approach can guide targeted mutagenesis studies and help interpret experimental results in the broader context of ATP synthase evolution.

What strategies can be employed to study the role of P. stutzeri atpB in metabolic engineering applications?

The ATP synthase subunit a (atpB) plays a critical role in energy metabolism, making it a potential target for metabolic engineering. Researchers can implement the following strategies:

  • Genetic modification approaches:

    • Knockout/complementation studies:

      • Generate atpB deletion mutants in P. stutzeri

      • Complement with wild-type or modified versions

      • Assess impact on growth, ATP production, and metabolite synthesis

    • Expression level modulation:

      • Use inducible promoters to control atpB expression

      • Evaluate the effect of atpB expression levels on cellular energetics

      • Optimize expression for specific biotechnological applications

  • Integration with other metabolic pathways:

    • Co-express atpB with other genes of interest such as the PHB biosynthesis genes (phbCAB) as demonstrated with P. stutzeri A1501

    • Analyze the energetic requirements of target pathways

    • Engineer ATP production to match the demands of engineered metabolic routes

  • Application-specific optimizations:

    • Bioproduction enhancement:

      • Examine the relationship between ATP synthesis and product formation

      • Optimize ATP synthase function for specific growth conditions

      • Engineer atpB variants with altered proton/ATP ratios

    • Stress response studies:

      • Investigate how atpB function relates to bacterial tolerance of stressors

      • Assess how metabolic engineering affects ATP synthase performance

      • Develop strains with enhanced energy efficiency under stress conditions

  • Systems biology approaches:

    • Conduct transcriptomic and proteomic analyses to understand how atpB expression affects global metabolism

    • Use metabolic flux analysis to map energy flows in engineered strains

    • Develop computational models to predict optimal atpB expression levels for specific applications

As seen in research with P. stutzeri A1501, modifications to metabolic pathways can significantly impact growth characteristics and product formation, such as the enhanced acetate utilization observed in certain mutants . Similar principles could be applied to investigate how atpB modifications might affect energy-dependent production pathways.

What are the most effective methods for purifying recombinant P. stutzeri atpB while maintaining its native conformation?

Purification of membrane proteins like P. stutzeri atpB presents significant challenges due to their hydrophobicity. A comprehensive purification strategy includes:

  • Solubilization optimization:

    • Detergent screening: Test multiple detergents (DDM, LMNG, digitonin) at various concentrations

    • Critical micelle concentration (CMC): Maintain detergent above CMC throughout purification

    • Lipid supplementation: Add specific phospholipids to stabilize native conformation

  • Chromatography steps:

    • Immobilized metal affinity chromatography (IMAC):

      • Use His-tag for initial capture from solubilized membranes

      • Apply gentle washing conditions to maintain protein-lipid interactions

      • Elute with imidazole gradient to minimize protein aggregation

    • Size exclusion chromatography (SEC):

      • Remove aggregates and non-specifically bound proteins

      • Assess oligomeric state of purified atpB

      • Verify homogeneity of preparation

  • Alternative purification approaches:

    • Styrene-maleic acid lipid particles (SMALPs):

      • Extract protein with native lipid environment intact

      • Avoid potentially denaturing detergents

      • Maintain native interactions with other membrane components

    • Amphipol exchange:

      • Replace detergents with amphipathic polymers

      • Improve long-term stability of purified protein

      • Enable detergent-free characterization studies

  • Quality control assessments:

    • SDS-PAGE to verify purity (should exceed 90%)

    • Western blotting to confirm identity

    • Circular dichroism to assess secondary structure integrity

    • Mass spectrometry to verify sequence and post-translational modifications

The purified protein should be maintained in a stabilizing buffer, such as Tris/PBS with 6% trehalose at pH 8.0, and used promptly or properly stored to prevent denaturation .

How can researchers effectively reconstitute and measure the activity of recombinant P. stutzeri atpB?

Functional reconstitution of P. stutzeri atpB is essential for biochemical and biophysical characterization. A methodological approach includes:

  • Reconstitution into proteoliposomes:

    • Lipid selection: Use E. coli polar lipids or defined mixtures mimicking P. stutzeri membranes

    • Protein:lipid ratio: Optimize ratios (typically 1:50 to 1:200 w/w) for activity

    • Reconstitution methods:

      • Detergent dialysis

      • Bio-bead-mediated detergent removal

      • Direct incorporation during liposome formation

  • Activity assay development:

    • Proton pumping assays:

      • Use pH-sensitive fluorescent dyes (ACMA, pyranine)

      • Measure fluorescence changes upon energization

      • Quantify proton transport rates under various conditions

    • ATP synthesis measurement:

      • Generate pH gradient across proteoliposome membrane

      • Add ADP and Pi

      • Quantify ATP formation using luciferase assay

  • Biophysical characterization:

    • Patch-clamp electrophysiology:

      • Measure ion conductance through reconstituted channels

      • Assess voltage dependence of channel activity

      • Determine the effect of mutations on channel properties

    • Structural studies in membrane mimetics:

      • Reconstitute in nanodiscs for single-particle cryo-EM

      • Use solid-state NMR for local structure determination

      • Apply EPR spectroscopy to measure distances between labeled residues

  • Coupling efficiency assessment:

    • Measure the H+/ATP ratio under various conditions

    • Determine the threshold proton-motive force required for ATP synthesis

    • Assess slip and leak phenomena in reconstituted systems

These methods provide complementary information about the functional properties of recombinant P. stutzeri atpB and its role in the ATP synthase complex.

How can P. stutzeri atpB be used as a model for investigating bacterial bioenergetics and membrane protein function?

P. stutzeri atpB serves as an excellent model system for studying fundamental aspects of bacterial bioenergetics and membrane protein function:

  • Comparative bioenergetic studies:

    • Cross-species analysis:

      • Compare P. stutzeri atpB with homologs from other bacteria

      • Identify species-specific adaptations in energy conservation

      • Elucidate evolutionary patterns in ATP synthase function

    • Environmental adaptation:

      • Study how P. stutzeri atpB is adapted to its ecological niche

      • Investigate functional variations in strains from different environments

      • Assess performance under various stress conditions

  • Membrane protein folding and assembly:

    • Use atpB as a model to study membrane protein insertion mechanisms

    • Investigate the role of chaperones in atpB folding

    • Examine how atpB integrates into the larger ATP synthase complex

  • Structure-function relationship paradigms:

    • Develop predictive models for proton translocation pathways

    • Map the interface between atpB and the c-ring

    • Identify critical residues for energy coupling

  • Applied research directions:

    • Design inhibitors targeting bacterial ATP synthases for antimicrobial development

    • Engineer atpB variants with altered efficiency for biotechnological applications

    • Develop P. stutzeri as a chassis for metabolic engineering projects

The study of P. stutzeri atpB contributes to our understanding of membrane protein biology while providing insights into bacterial adaptation and energy conservation strategies.

What techniques can be used to investigate the integration of P. stutzeri atpB into metabolic engineering applications?

Incorporating P. stutzeri atpB research into metabolic engineering requires specialized techniques to understand and optimize energy metabolism:

  • Metabolic flux analysis:

    • Use 13C-labeled substrates to track carbon flow through central metabolism

    • Quantify the impact of atpB modifications on flux distributions

    • Identify rate-limiting steps in energy-dependent pathways

  • Intracellular ATP monitoring:

    • Implement ATP biosensors for real-time measurement in living cells

    • Correlate ATP levels with expression of recombinant proteins or metabolites

    • Optimize culture conditions based on energetic status

  • Integration with established metabolic engineering platforms:

    • Combine atpB modifications with engineering of central carbon metabolism

    • Test compatibility with existing metabolic engineering strategies

    • Develop strains with enhanced energetic efficiency for bioproduction

  • Case study: PHB production optimization:

    • Research has demonstrated that P. stutzeri can be engineered for PHB production through expression of phbCAB genes from R. eutropha H16

    • This system could be further optimized by:

      • Investigating how ATP synthase function affects PHB accumulation

      • Engineering atpB to enhance energy efficiency during PHB synthesis

      • Developing strains with both optimized carbon flow and energy generation

  • Monitoring techniques for process development:

    • Real-time measurements of respiration rates and membrane potential

    • Correlation of ATP synthesis rates with product formation

    • Development of feedback control systems based on energetic parameters

The successful integration of P. stutzeri atpB in metabolic engineering requires a multidisciplinary approach combining membrane biochemistry, bacterial physiology, and systems biology.

What are common challenges in working with recombinant P. stutzeri atpB and how can they be addressed?

Researchers working with recombinant P. stutzeri atpB frequently encounter the following challenges and solutions:

  • Low expression yield:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solutions:

      • Use specialized E. coli strains (C41, C43) designed for membrane protein expression

      • Optimize codon usage for expression host

      • Lower induction temperature (16-20°C) and inducer concentration

      • Consider fusion tags known to enhance membrane protein expression (MBP, SUMO)

  • Protein aggregation during purification:

    • Challenge: Hydrophobic membrane proteins tend to aggregate when removed from the membrane

    • Solutions:

      • Screen multiple detergents and concentrations

      • Add lipids during solubilization and purification

      • Maintain protein at higher dilutions

      • Include stabilizing agents like glycerol or trehalose

  • Loss of activity during purification:

    • Challenge: Native conformation may be disrupted during extraction and purification

    • Solutions:

      • Minimize time between cell disruption and protein purification

      • Maintain all buffers at 4°C

      • Include protease inhibitors and reducing agents

      • Consider milder extraction methods (SMA polymers, digitonin)

  • Difficulties in functional reconstitution:

    • Challenge: Achieving proper orientation and density in artificial membranes

    • Solutions:

      • Test different reconstitution methods and lipid compositions

      • Optimize protein:lipid ratios

      • Verify reconstitution success by freeze-fracture electron microscopy

      • Include other subunits of ATP synthase for full functional studies

  • Instability during storage:

    • Challenge: Purified membrane proteins often lose activity during storage

    • Solutions:

      • Store in small aliquots at -80°C

      • Avoid repeated freeze-thaw cycles

      • Consider lyophilization with appropriate cryoprotectants

      • For short-term storage, maintain at 4°C rather than freezing

By systematically addressing these challenges, researchers can improve the yield, purity, and functionality of recombinant P. stutzeri atpB preparations.

How can researchers optimize experimental conditions for structural and functional studies of P. stutzeri atpB?

Optimization of experimental conditions is crucial for successful structural and functional studies of P. stutzeri atpB:

  • Structural studies optimization:

    • Crystallization screening:

      • Test various detergents and lipid additives

      • Screen temperature, pH, and precipitant conditions

      • Consider lipidic cubic phase crystallization

    • Cryo-EM sample preparation:

      • Optimize protein concentration and grid type

      • Test various vitrification conditions

      • Consider nanodiscs or amphipols for improved particle distribution

    • NMR studies:

      • Use selective labeling strategies for complex membrane proteins

      • Optimize reconstitution in bicelles or nanodiscs

      • Develop specialized pulse sequences for membrane protein studies

  • Functional assays optimization:

    • Buffer composition:

      • Test various pH values and ionic strengths

      • Optimize magnesium concentration for ATP synthesis assays

      • Include stabilizing agents like trehalose

    • Temperature effects:

      • Determine temperature optima for P. stutzeri atpB activity

      • Investigate temperature-dependent conformational changes

      • Develop thermostability assays for mutant screening

    • Substrate concentrations:

      • Establish Michaelis-Menten kinetics for ATP synthesis

      • Determine optimal ADP and Pi concentrations

      • Measure effects of inhibitors at various concentrations

  • Proteoliposome optimization:

    • Systematically vary lipid composition to mimic native membrane

    • Test protein:lipid ratios for optimal activity

    • Measure size distribution and lamellarity of proteoliposomes

    • Determine optimal methods for generating proton gradients

  • Data analysis refinement:

    • Develop mathematical models for complex kinetic data

    • Use global fitting approaches for multi-parameter experiments

    • Apply statistical methods to evaluate significance of observed differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.