Recombinant Pseudomonas stutzeri ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; PST_4195; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
atpF
Target Protein Sequence
MNINLTLFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDK VSHTLRETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQL RSQVAALAVAGAEKILESQVDAKVHNELVEKLASQL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous F(1) catalytic core and the membrane-bound F(0) proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does P. stutzeri atpF differ from other bacterial ATP synthase b subunits?

While the core function of ATP synthase is conserved across species, P. stutzeri atpF shows adaptations that may reflect its ecological versatility. Compared to other bacterial species:

  • The P. stutzeri atpF maintains the characteristic N-terminal membrane anchor and C-terminal helical domain structure common to bacterial F-type ATP synthases

  • Subtle amino acid variations may exist in regions that interact with other ATP synthase subunits, potentially reflecting adaptations to different environmental conditions faced by P. stutzeri, which is known for its metabolic versatility including denitrification capabilities

  • The gene is located in the ATP synthase operon similar to other Pseudomonas species, but gene regulation may differ based on the organism's ability to grow under varying oxygen conditions

What are the optimal conditions for expression and purification of recombinant P. stutzeri atpF?

Successful expression and purification of recombinant P. stutzeri atpF requires careful optimization:

Expression System:

  • Expression host: E. coli is typically used, as indicated in product literature

  • Vector selection: Expression vectors with appropriate promoters and fusion tags to enhance solubility

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein solubility

  • Induction: Mild induction conditions to prevent inclusion body formation

Purification Protocol:

  • Cell lysis in appropriate buffer systems

  • Initial capture via affinity chromatography (if tagged protein is used)

  • Detergent selection for membrane protein solubilization

  • Buffer composition with stabilizers (50% glycerol is recommended for storage)

  • Purification to >85% homogeneity as confirmed by SDS-PAGE

Storage Conditions:

  • Short-term: 4°C for up to one week

  • Long-term: -20°C or preferably -80°C with glycerol as cryoprotectant

  • Avoid repeated freeze-thaw cycles

How can I validate the structural integrity of purified recombinant atpF?

Multiple complementary approaches should be used to validate recombinant atpF:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Dynamic light scattering to assess monodispersity

    • Thermal shift assays to evaluate protein stability

  • Functional validation:

    • Binding assays with other ATP synthase components

    • Reconstitution experiments in liposomes

    • Proton translocation assays if reconstituted with other F0 components

  • Structural verification:

    • Limited proteolysis to confirm proper folding

    • Mass spectrometry to verify molecular weight and post-translational modifications

    • Analytical ultracentrifugation to determine oligomeric state

How can recombinant atpF be used to study P. stutzeri bioenergetics in varying oxygen conditions?

P. stutzeri is known for its metabolic flexibility, including denitrification capabilities under oxygen-limited conditions . Recombinant atpF can be utilized to investigate bioenergetic adaptations:

  • Comparative structural studies:

    • Analyze structural differences in ATP synthase components between aerobic and anaerobic growth conditions

    • Use purified recombinant atpF for in vitro reconstitution experiments with other ATP synthase components

  • Mutational analysis:

    • Generate site-directed mutations in conserved residues to assess their impact on ATP synthase function

    • Complement atpF-deficient strains with mutant versions to evaluate in vivo effects on growth under different oxygen tensions

  • Interaction mapping:

    • Identify differential protein-protein interactions of atpF under varying oxygen conditions

    • Use cross-linking mass spectrometry to map interaction interfaces

  • Biophysical comparisons:

    • Compare stability and structural parameters of atpF isolated from cells grown under aerobic versus denitrifying conditions

    • Measure ATP synthesis rates in reconstituted systems under different conditions

What is the relationship between atpF and nitrogen fixation in diazotrophic P. stutzeri strains?

Some P. stutzeri strains, such as A1501, possess nitrogen fixation capabilities , which creates unique bioenergetic challenges:

  • Energy management:

    • Nitrogen fixation is highly energy-intensive, requiring approximately 16 ATP molecules per N₂ reduced

    • ATP synthase efficiency becomes crucial for supporting both nitrogen fixation and regular cellular processes

  • Oxygen protection mechanisms:

    • Nitrogenase is extremely oxygen-sensitive, necessitating protection mechanisms

    • ATP synthase activity may be regulated differently in nitrogen-fixing strains to balance energy production with oxygen sensitivity

  • Research approaches:

    • Compare atpF sequence and expression between nitrogen-fixing (e.g., A1501) and non-fixing P. stutzeri strains

    • Investigate potential co-regulation of ATP synthase genes and nitrogen fixation genes

    • Examine ATP synthesis rates during active nitrogen fixation versus non-fixing conditions

The regulatory noncoding RNA NfiS identified in P. stutzeri A1501 has been shown to coordinate oxidative stress response and nitrogen fixation , suggesting complex regulatory networks that may also involve energy production.

What strategies can overcome expression difficulties with recombinant P. stutzeri atpF?

As a membrane-associated protein, atpF presents several expression challenges:

  • Codon optimization:

    • Analyze codon usage differences between P. stutzeri and expression host

    • Design synthetic genes with optimized codons for the expression system

  • Fusion partners:

    • Test different fusion tags (His, MBP, GST) to identify optimal solubility enhancement

    • Consider using specialized tags for membrane protein expression

  • Expression conditions matrix:

    ParameterVariables to Test
    Temperature16°C, 25°C, 30°C, 37°C
    Induction0.1 mM, 0.5 mM, 1.0 mM IPTG
    MediaLB, TB, 2xYT, Autoinduction
    Time4h, 8h, 16h, 24h
    AdditivesGlycerol, Detergents, Osmolytes
  • Alternative expression systems:

    • Cell-free protein synthesis systems

    • Specialized membrane protein expression strains

    • Homologous expression in Pseudomonas species

How can I troubleshoot functional assays for recombinant ATP synthase components?

Functional characterization of ATP synthase components presents unique challenges:

  • Assembly validation:

    • Native PAGE to confirm complex formation

    • Size exclusion chromatography to analyze complex integrity

    • Immunoprecipitation to verify subunit interactions

  • Activity measurements:

    • ATP synthesis assays in reconstituted proteoliposomes

    • ATP hydrolysis measurements (reverse reaction)

    • Proton pumping assays using pH-sensitive fluorescent dyes

  • Common issues and solutions:

    ProblemSolution
    Low activityOptimize lipid composition for reconstitution
    Protein instabilityInclude stabilizing agents (glycerol, specific lipids)
    Poor complex assemblyCo-expression of multiple subunits
    High backgroundImprove purification protocol; use specific inhibitors
    Variable resultsStandardize reconstitution procedures

How can structural studies of P. stutzeri atpF advance our understanding of bacterial bioenergetics?

While detailed structural studies specific to P. stutzeri atpF are not extensively documented in the available literature, several advanced approaches could provide valuable insights:

  • Cryo-electron microscopy (cryo-EM):

    • Determine high-resolution structure of complete P. stutzeri ATP synthase

    • Compare structures under different physiological conditions (aerobic vs. denitrifying)

  • Integrative structural biology:

    • Combine X-ray crystallography, NMR, SAXS, and computational modeling

    • Map conformational changes during the catalytic cycle

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor subunit movements

    • Optical tweezers to measure force generation during ATP synthesis

  • Computational approaches:

    • Molecular dynamics simulations to examine proton translocation mechanisms

    • Coevolutionary analysis to identify critical interaction networks

These structural insights would be particularly valuable given P. stutzeri's metabolic versatility and adaptation to diverse environmental conditions .

What role might atpF play in biofilm formation and environmental adaptation of P. stutzeri?

P. stutzeri has been studied for its biofilm interactions and environmental adaptations , suggesting potential roles for ATP synthase in these processes:

  • Biofilm energetics:

    • Energy production requirements differ in biofilm versus planktonic growth

    • ATP synthase efficiency may be modulated in biofilm conditions

  • Stress adaptation:

    • ATP synthase function during environmental challenges (pH, temperature, osmotic stress)

    • Potential regulatory links between energy production and stress response systems

  • Interspecies interactions:

    • Role of energy metabolism in competitive or cooperative interactions, as observed in P. stutzeri co-cultures used for bioremediation, biocontrol, and wastewater denitrification

    • Energy allocation during establishment of symbiotic relationships, such as with rice plants in nitrogen-fixing strains

  • Research methodologies:

    • Biofilm Interaction Mapping and Analysis (BIMA) approaches could be adapted to study the role of ATP synthase components

    • Genetic approaches including deletion mutants and complementation studies

    • Comparative proteomics of ATP synthase components in different growth conditions

How might atpF be utilized in synthetic biology applications with P. stutzeri?

The metabolic versatility of P. stutzeri makes it an attractive platform for synthetic biology applications, with ATP synthase playing a central role in energy production:

  • Bioremediation enhancement:

    • Optimizing energy production for improved degradation of aromatic compounds

    • Engineering ATP synthase efficiency for growth on challenging substrates

  • Nitrogen fixation engineering:

    • Balancing energy production with nitrogenase oxygen sensitivity

    • Improving ATP synthase efficiency to support the high energy demands of nitrogen fixation

  • Bioproduction applications:

    • Engineering energy metabolism for poly-3-hydroxybutyrate (PHB) production from acetate, as demonstrated with recombinant P. stutzeri

    • Optimizing ATP production for synthesis of other valuable metabolites

  • Modular redesign approaches:

    • Swapping ATP synthase components between species to create hybrid complexes with novel properties

    • Engineering regulatory controls to modulate energy production based on growth conditions or product synthesis needs

These applications would build upon P. stutzeri's natural capabilities for nitrogen fixation, denitrification, aromatic compound degradation, and adaptability to diverse environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.