Recombinant Pseudomonas stutzeri Cbb3-type cytochrome c oxidase subunit CcoP1 (ccoP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ccoP1; Cbb3-type cytochrome c oxidase subunit CcoP1; Cbb3-Cox subunit CcoP1; C-type cytochrome CcoP1; Cyt c(P1; Cytochrome c oxidase subunit III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Pseudomonas stutzeri (Pseudomonas perfectomarina)
Target Names
ccoP1
Target Protein Sequence
MSTFWSGYIALLTLGTIVALFWLIFATRKGESAGTTDQTMGHAFDGIEEYDNPLPRWWFL LFIGTLVFGILYLVLYPGLGNWKGVLPGYEGGWTQEKQWEREVAQADEKYGPIFAKYAAM SVEEVAQDPQAVKMGARLFANYCSICHGSDAKGSLGFPNLADQDWRWGGDAASIKTSILN GRIAAMPAWGQAIGEEGVKNVAAFVRKDLAGLPLPEGTDADLSAGKNVYAQTCAVCHGQG GEGMAALGAPKLNSAAGWIYGSSLGQLQQTIRHGRNGQMPAQQQYLGDDKVHLLAAYVYS LSQKPEQLANQ
Uniprot No.

Target Background

Function
C-type cytochrome; a component of the cbb3-type cytochrome c oxidase complex. The CcoP subunit facilitates electron transfer from donor cytochrome c via its heme groups to the CcoO subunit. Electrons are subsequently transferred to the catalytic binuclear center of the CcoN subunit for oxygen reduction. The complex also functions as a proton pump.
Protein Families
CcoP / FixP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Cbb3-type cytochrome c oxidase in Pseudomonas stutzeri?

The Cbb3-type cytochrome c oxidase in Pseudomonas stutzeri serves as a terminal oxidase in the respiratory chain, catalyzing the reduction of molecular oxygen to water. This enzyme complex has a distinctively high affinity for oxygen, which enables P. stutzeri to thrive in microaerobic or oxygen-limited environments. The complex plays an essential role in the bacterium's adaptation to low-oxygen conditions, functioning as part of the electron transport pathway that generates the proton motive force necessary for ATP synthesis. In P. stutzeri, this adaptation mechanism is particularly significant as it allows the organism to occupy diverse ecological niches with varying oxygen availability . This respiratory flexibility contributes to the metabolic versatility that characterizes P. stutzeri strains and their ability to function in natural environments with fluctuating oxygen levels .

What is the structural composition of the CcoP1 subunit and how does it relate to the complete Cbb3-type cytochrome c oxidase complex?

The CcoP1 subunit of P. stutzeri Cbb3-type cytochrome c oxidase consists of 311 amino acids with a sequence that includes multiple heme-binding domains. According to structural information, CcoP1 contains a transmembrane region near the N-terminus followed by a periplasmic domain containing two c-type heme binding motifs (CXXCH). The complete amino acid sequence of CcoP1 begins with "MSTFWSGYIALLTLGTIVALFWLIFATRKGESAGTTDQTMGH..." and continues through to the C-terminal region . Within the complete Cbb3-type cytochrome c oxidase complex, CcoP1 functions alongside other subunits including CcoN (the catalytic subunit containing heme b and a binuclear center), CcoO (another c-type cytochrome), and potentially CcoQ (a small protein that may have regulatory functions). CcoP1 likely serves as an electron transfer component, accepting electrons from other members of the respiratory chain and transferring them to the catalytic center in CcoN where oxygen reduction occurs .

Why is P. stutzeri used as a model organism for studying Cbb3-type cytochrome c oxidase?

P. stutzeri serves as an excellent model organism for studying Cbb3-type cytochrome c oxidase for several compelling reasons. First, P. stutzeri is genetically tractable and metabolically diverse, facilitating both genetic manipulation and physiological studies across various growth conditions. Second, it serves as a model for the clinically relevant opportunistic pathogen Pseudomonas aeruginosa, making findings potentially translatable to understanding pathogenicity mechanisms . Third, P. stutzeri has a relatively stable and well-characterized genome compared to other Pseudomonas species; its genome encodes 74 transposases, nearly four times as many as annotated for P. aeruginosa MPAO1 . Additionally, recent completion of the full genome sequence provides comprehensive data for system-wide studies of proteins including the Cbb3-type cytochrome c oxidase components. Finally, P. stutzeri's natural ability to adapt to varying oxygen concentrations makes it particularly suitable for investigating the role of high-affinity terminal oxidases in bacterial respiration and environmental adaptation .

How does the expression of recombinant CcoP1 in heterologous systems affect protein folding and function?

The expression of recombinant P. stutzeri CcoP1 in heterologous systems like E. coli presents significant challenges that can affect protein folding and function. When expressed as a recombinant protein with an N-terminal His-tag in E. coli, several factors must be considered that could impact the native structure and activity of CcoP1 . First, the absence of the complete Cbb3 assembly machinery in E. coli may lead to improper folding or incomplete maturation of CcoP1. This is particularly relevant for the incorporation of heme groups, which are essential for electron transfer function. E. coli's cytochrome c maturation (Ccm) system differs from that of Pseudomonas, potentially resulting in incorrect or incomplete heme incorporation into the CXXCH motifs of CcoP1. Additionally, the presence of an N-terminal His-tag may interfere with membrane insertion, especially since the N-terminal region of CcoP1 contains a transmembrane segment (as inferred from its amino acid sequence: "MSTFWSGYIALLTLGTIVALFWLIFATRKGES...") .

The recombinant protein may also lack post-translational modifications present in the native form, further affecting its structure-function relationship. To address these challenges, researchers often need to optimize expression conditions (temperature, induction time, media composition) and consider co-expression with chaperones or cytochrome c maturation proteins. Alternatively, expression in other Gram-negative hosts phylogenetically closer to Pseudomonas might improve the functional yield of recombinant CcoP1.

What methodological approaches can be used to assess the interaction between CcoP1 and other subunits of the Cbb3-type cytochrome c oxidase complex?

Investigating the interactions between CcoP1 and other subunits of the Cbb3-type cytochrome c oxidase complex requires multiple complementary approaches to comprehensively understand both structural associations and functional relationships. Co-immunoprecipitation (Co-IP) using antibodies against CcoP1 or against tags on recombinant versions can identify interacting partners from solubilized membrane fractions. This approach can be supplemented with crosslinking studies using chemical crosslinkers of varying spacer arm lengths to capture both direct and proximal interactions within the complex. For more detailed analysis, pull-down assays using recombinant His-tagged CcoP1 can be performed with membrane fractions containing other Cco subunits.

Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative data on binding affinities between purified CcoP1 and other individual subunits. To visualize these interactions in a cellular context, fluorescence resonance energy transfer (FRET) between fluorescently labeled subunits can be employed in living bacterial cells. For structural insights, cryo-electron microscopy of the purified complex would reveal the spatial arrangement of CcoP1 relative to other subunits.

Functional interaction studies could utilize the oxygen consumption assay with ascorbate/TMPD as electron donors (as described for Campylobacter jejuni) , comparing activity in reconstituted systems with varying subunit compositions. Site-directed mutagenesis of potential interface residues in CcoP1, followed by activity and assembly analysis, would further identify critical interaction points. Together, these approaches would provide a comprehensive understanding of how CcoP1 integrates structurally and functionally within the Cbb3-type cytochrome c oxidase complex.

How does copper availability influence the assembly and function of Cbb3-type cytochrome c oxidase containing CcoP1?

Copper availability plays a critical role in the assembly and function of Cbb3-type cytochrome c oxidase containing CcoP1, affecting both the enzyme's biogenesis and catalytic activity. The catalytic subunit of Cbb3-type oxidase contains a binuclear center consisting of heme b3 and a copper ion (CuB) that serves as the site for oxygen reduction. Insufficient copper availability can lead to incomplete assembly of this center, resulting in non-functional or partially functional enzyme complexes even when all protein subunits, including CcoP1, are properly expressed.

Research on related systems suggests that copper supplementation significantly impacts Cbb3-type oxidase activity and assembly. For instance, in Campylobacter jejuni, copper supplementation (0.1-5.0 mM CuSO4) to growth media affects the enzyme's activity as measured by oxygen consumption . Mechanistically, copper incorporation into the Cbb3 complex likely involves specialized metallochaperones that deliver copper specifically to the assembly site within the membrane. The absence of these chaperones or insufficient copper would impair this process.

While CcoP1 itself does not directly bind copper, its integration into the holoenzyme complex may depend on proper copper incorporation into the CcoN subunit. Copper deficiency could therefore indirectly affect CcoP1 incorporation or stability within the complex. Additionally, copper limitation might trigger compensatory regulatory mechanisms that alter the expression levels of different oxidase subunits, including CcoP1, as the bacterium attempts to optimize its respiratory capacity under metal-limited conditions. Researchers investigating recombinant CcoP1 should therefore carefully consider copper availability in their experimental systems, particularly when studying assembly with other Cco subunits or when assessing functional activity of reconstituted complexes.

What is the optimal protocol for reconstituting and stabilizing recombinant CcoP1 protein?

The optimal protocol for reconstituting and stabilizing recombinant P. stutzeri CcoP1 protein involves multiple critical steps to ensure proper solubilization, folding, and long-term stability. Based on available product information, the lyophilized recombinant CcoP1 protein should first be briefly centrifuged prior to opening to bring the contents to the bottom of the vial . The protein should then be reconstituted in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, it is strongly recommended to add glycerol to a final concentration between 5-50%, with 50% being the standard recommendation for optimal stability .

After reconstitution, the solution should be gently mixed without vigorous shaking or vortexing to prevent protein denaturation or aggregation. The reconstituted protein should be aliquoted into smaller volumes to avoid repeated freeze-thaw cycles, which significantly compromise protein integrity. For short-term use, aliquots can be stored at 4°C for up to one week, while long-term storage requires -20°C or preferably -80°C conditions .

For experimental applications requiring membrane incorporation, the reconstituted CcoP1 may need to be incorporated into liposomes or nanodiscs. This typically involves mixing the protein with appropriate phospholipids (often a mixture mimicking bacterial membranes) in the presence of detergents, followed by detergent removal through dialysis or using bio-beads. The buffer system used throughout should maintain pH at approximately 8.0, as indicated by the Tris/PBS-based storage buffer utilized for the commercial recombinant protein . This comprehensive approach maximizes both the functional integrity and shelf-life of the recombinant CcoP1 protein.

How can researchers measure Cbb3-type cytochrome c oxidase activity in systems containing recombinant CcoP1?

Measuring Cbb3-type cytochrome c oxidase activity in systems containing recombinant CcoP1 requires specialized techniques that account for the unique properties of this high-affinity terminal oxidase. The most direct approach utilizes oxygen consumption measurements with a Clark-type oxygen electrode, similar to methods established for Campylobacter jejuni Cbb3 oxidase . In this experimental setup, the electrode chamber should contain a suitable buffer (typically 25 mM sodium phosphate buffer, pH 7.4) calibrated to known oxygen concentrations (approximately 220 nmol dissolved O2 ml-1 at physiological temperatures) .

The specific electron donor system for Cbb3-type oxidases consists of 0.25 mM tetramethyl-p-phenylenediamine (TMPD) plus 1 mM sodium ascorbate. This combination specifically donates electrons to c-type cytochromes, thereby selectively measuring Cbb3 oxidase activity . The reaction is initiated by adding the reconstituted enzyme system containing CcoP1 (either purified complex, membrane fractions, or whole cells expressing the recombinant proteins) to the electrode chamber. The rate of oxygen consumption is recorded and calculated as nmol oxygen consumed min-1 mg-1 total protein.

What strategies can be employed to improve the expression yield and purity of recombinant CcoP1?

Improving the expression yield and purity of recombinant CcoP1 requires a multi-faceted approach addressing the challenges inherent in producing membrane-associated proteins with cofactors. Several strategic optimizations can significantly enhance both quantity and quality of the recombinant protein. First, selecting an appropriate expression host is crucial - while E. coli is commonly used , alternative hosts like Pseudomonas species may provide better machinery for proper folding and cofactor incorporation of CcoP1. When using E. coli, strains specifically engineered for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results.

Expression vectors should be carefully designed to include optimal codon usage for the host and appropriate fusion tags that facilitate both expression and purification. While N-terminal His-tags are common , alternative positions for the tag or dual tagging strategies may improve both expression and function. Expression conditions should be systematically optimized, including parameters such as growth temperature (often lowered to 16-20°C for membrane proteins), induction timing and intensity (using reduced IPTG concentrations), and media composition (potentially supplemented with heme precursors like δ-aminolevulinic acid).

For improved purity during isolation, a sequential purification strategy is recommended, beginning with immobilized metal affinity chromatography (IMAC) using the His-tag, followed by size exclusion chromatography to remove aggregates and ion exchange chromatography for final polishing. Detergent selection is critical for membrane protein purification - mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often preserve protein structure better than harsher alternatives.

The purification process should be monitored using SDS-PAGE to confirm achievement of >90% purity , with additional quality control by spectroscopic methods to verify heme incorporation. Implementation of these coordinated strategies can substantially improve both the yield and functional quality of recombinant CcoP1 preparations.

How can recombinant CcoP1 contribute to understanding bacterial adaptation to oxygen-limited environments?

Recombinant CcoP1 serves as a powerful tool for elucidating the molecular mechanisms underlying bacterial adaptation to oxygen-limited environments, a critical process for many pathogens during infection. Cbb3-type cytochrome c oxidases have exceptionally high affinity for oxygen, enabling bacteria to respire under microaerobic conditions where other terminal oxidases would be ineffective . By producing and studying recombinant CcoP1 alongside other components of this specialized respiratory complex, researchers can dissect the structural and functional elements that confer this high oxygen affinity.

In vitro reconstitution experiments using purified recombinant CcoP1 combined with other Cbb3 oxidase subunits allow for detailed kinetic studies across oxygen gradients, revealing how electron transfer rates and oxygen binding properties change under varying oxygen tensions. Site-directed mutagenesis of specific residues in recombinant CcoP1 can identify amino acids critical for function under oxygen limitation. These studies can be complemented by in vivo approaches where wild-type CcoP1 in P. stutzeri is replaced with modified versions, followed by growth and survival analysis under controlled oxygen limitation.

The knowledge gained from such studies has broader implications beyond P. stutzeri. Since this organism serves as a model for the clinically relevant pathogen P. aeruginosa , insights into how CcoP1 contributes to oxygen-limited respiration could elucidate how pathogens persist in oxygen-restricted infection sites such as biofilms, abscesses, or the cystic fibrosis lung. Furthermore, comparative studies of CcoP1 variants across Pseudomonas species occupying different ecological niches could reveal evolutionary adaptations to specific oxygen regimes, contributing to our understanding of bacterial respiratory diversification and environmental adaptation.

What insights can studies of P. stutzeri CcoP1 provide for understanding the pathogenicity of related organisms like Pseudomonas aeruginosa?

Studies of P. stutzeri CcoP1 offer valuable insights into P. aeruginosa pathogenicity through comparative respiratory physiology analysis. P. stutzeri serves as an established model for the clinically significant opportunistic pathogen P. aeruginosa, with both organisms sharing key respiratory components including the high-affinity Cbb3-type cytochrome c oxidase . This respiratory complex is particularly important during infection scenarios where P. aeruginosa encounters oxygen-limited environments, such as within biofilms, mucus-filled airways in cystic fibrosis patients, or deep wound tissues.

By characterizing the structure, function, and regulation of CcoP1 in P. stutzeri, researchers can infer mechanisms that enable P. aeruginosa to persist in these challenging host environments. For instance, understanding how the P. stutzeri Cbb3 complex containing CcoP1 efficiently captures and utilizes limited oxygen could explain how P. aeruginosa maintains energy production during chronic infections despite neutrophil-mediated oxygen depletion. The oxygen-sensing and respiratory adaptation mechanisms linked to CcoP1 function may also illuminate how P. aeruginosa regulates virulence factor expression in response to varying oxygen availability within host tissues.

Comparative genomic analysis reveals that P. stutzeri has a genome approximately 35% larger than certain P. aeruginosa strains, encoding nearly four times as many transposases . This genomic context may provide insights into the evolutionary history and horizontal gene transfer events that shaped respiratory adaptation in both species. Furthermore, by studying the interaction of P. stutzeri CcoP1 with other respiratory components and regulatory systems, researchers can identify potential intervention points that might be exploited for novel therapeutic approaches against P. aeruginosa infections, particularly those occurring in oxygen-limited niches where conventional antibiotics may have reduced efficacy.

How might structural studies of recombinant CcoP1 inform the development of inhibitors targeting bacterial respiration?

Structural studies of recombinant CcoP1 could significantly advance the development of targeted inhibitors against bacterial respiration, particularly for pathogens that rely on Cbb3-type cytochrome c oxidases during infection. The Cbb3-type oxidase represents an attractive antimicrobial target due to its essential role in bacterial adaptation to oxygen-limited environments and its absence in human cells . Detailed structural information on CcoP1 would reveal potential binding pockets and interaction surfaces that could be exploited for inhibitor design.

High-resolution structural data of recombinant CcoP1, obtained through X-ray crystallography or cryo-electron microscopy, would illustrate the precise arrangement of heme groups and their surrounding amino acid residues. This information is critical for designing compounds that could interfere with electron transfer between CcoP1 and other subunits of the complex. Additionally, mapping the interaction interfaces between CcoP1 and other Cco subunits could identify peptide regions suitable for developing protein-protein interaction inhibitors that disrupt complex assembly.

The distinct c-type heme binding motifs in CcoP1, with their specific CXXCH sequences , represent potential targets for compounds that could either prevent heme incorporation or displace bound heme groups. Computational approaches utilizing structural data, such as molecular docking and dynamic simulations, could efficiently screen virtual compound libraries for potential CcoP1 binders. Promising candidates could then be synthesized and tested in functional assays measuring oxygen consumption, as established for similar systems .

Importantly, comparing the structures of CcoP1 from different bacterial species could identify both conserved regions (for broad-spectrum inhibitors) and variable regions (for species-selective compounds). This structural knowledge would facilitate rational drug design approaches targeting respiratory systems in pathogens like P. aeruginosa that rely on Cbb3-type oxidases during infection, potentially leading to novel therapeutics effective against antibiotic-resistant bacteria in oxygen-limited infection sites.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.