Recombinant Pseudomonas stutzeri Cbb3-type cytochrome c oxidase subunit CcoP2 (ccoP2)

Shipped with Ice Packs
In Stock

Description

Overview of Pseudomonas stutzeri Cbb3-type Cytochrome c Oxidase Subunit CcoP2 (CcoP2)

Pseudomonas stutzeri is a Gram-negative bacterium widely distributed in various environments and possesses a branched respiratory chain, enabling it to adapt to diverse conditions . The bacterium contains two independent ccoNO(Q)P operons that encode two cbb3 isoforms, Cbb3-1 and Cbb3-2 . These operons contain the structural genes for the subunits CcoN, CcoO, and CcoP, but the ccoQ gene is present only in the second cbb3 operon (ccoNOQP-2) . The amino acid sequence identity between the two cbb3 isoforms is high: 87% for subunit CcoN, 97% for subunit CcoO, and 63% for subunit CcoP .

Significance of CcoP2 Subunit

The Cbb3-type cytochrome c oxidase is a crucial component of the respiratory chain in P. stutzeri, particularly under microaerobic conditions . The CcoP subunit is an essential part of this oxidase complex. Understanding the structure, function, and regulation of CcoP2, the isoform specific to the ccoNOQP-2 operon, is vital for elucidating the bacterium's respiratory mechanisms and its adaptation to varying oxygen concentrations .

Recombinant Production and Purification

Due to the high homology between Cbb3-1 and Cbb3-2, purification of the individual isoforms from native membranes is challenging . To overcome this, a homologous expression system was developed, utilizing P. stutzeri deletion strains and an expression vector . This approach allows for the separate production and purification of the two recombinant cbb3 isoforms using affinity chromatography . Specifically, a Strep-tag II is fused to the C terminus of ccoN-1 and ccoN-2 for affinity purification .

Genetic Organization and Regulation

In P. stutzeri, a 12-kb genomic DNA fragment contains two cbb3 operons (ccoNOP-1 and ccoNOQP-2) and a ccoGHIS gene cluster . Each of the two cbb3 operons encodes subunits of the two isoforms of cbb3-CcO, namely, Cbb3-1 and Cbb3-2 . Both operons contain the genes for CcoN, CcoO, and CcoP, while the ccoQ gene is found only in ccoNOQP-2 . A consensus arginine nitrate regulation (ANR), or fumarate and nitrate reduction regulator (FNR), binding motif (TTGAT-N4-gTCAA) is located directly upstream of the ccoN-1 transcription start site . The ccoGHIS cluster, located 137 bp downstream of ccoNOQP-2, is required for the maturation and assembly of a functional cbb3-CcO .

Regulatory Elements and Transcriptional Control

Expression of the two cbb3 isoforms is regulated at the transcriptional level in response to the peripheral oxygen concentration . Promoters of the two cbb3 operons contain different regulatory elements. Both promoters (P1 and P2) contain the putative sigma factor RpoD (σ70) binding site (−35 and −10 regions), while only the P1 promoter possesses a consensus binding site for the transcription activator ANR (a homologue of E. coli FNR), which is centered at position −95.5 relative to the start codon of ccoN-1 and overlaps with the −35 region by one base pair .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us for preferential development.
Synonyms
ccoP2; Cbb3-type cytochrome c oxidase subunit CcoP2; Cbb3-Cox subunit CcoP2; C-type cytochrome CcoP2; Cyt c(P2; Cytochrome c oxidase subunit III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Pseudomonas stutzeri (Pseudomonas perfectomarina)
Target Names
ccoP2
Target Protein Sequence
MTSFWSWYVTLLSLGTIAALVWLLLATRKGQRPDSTEETVGHSYDGIEEYDNPLPRWWFM LFVGTVIFALGYLVLYPGLGNWKGILPGYEGGWTQVKEWQREMDKANEQYGPLYAKYAAM PVEEVAKDPQALKMGGRLFASNCSVCHGSDAKGAYGFPNLTDDDWLWGGEPETIKTTILH GRQAVMPGWKDVIGEEGIRNVAGYVRSLSGRDTPEGISVDIEQGQKIFAANCVVCHGPEA KGVTAMGAPNLTDNVWLYGSSFAQIQQTLRYGRNGRMPAQEAILGNDKVHLLAAYVYSLS QQPEQ
Uniprot No.

Target Background

Function

Recombinant Pseudomonas stutzeri Cbb3-type cytochrome c oxidase subunit CcoP2 (ccoP2): A c-type cytochrome and component of the cbb3-type cytochrome c oxidase complex. The CcoP subunit facilitates electron transfer from donor cytochrome c (via its heme groups) to the CcoO subunit. Subsequently, electrons are transferred to the catalytic binuclear center of the CcoN subunit, enabling oxygen reduction. This complex also functions as a proton pump.

Protein Families
CcoP / FixP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CcoP2 in the Cbb3-type cytochrome c oxidase complex?

CcoP2 serves as a critical electron transfer component within the Cbb3-2 oxidase complex in Pseudomonas stutzeri. As a membrane-bound c-type cytochrome, CcoP2 channels electrons from the donor cytochrome into the binuclear center in the CcoN subunit where oxygen reduction occurs. Spectroscopic analyses have revealed that CcoP2 contains multiple c-type hemes that facilitate this electron transfer function. These hemes form part of the electron transfer pathway from the donor to the catalytic site where oxygen is reduced .

How does CcoP2 differ structurally from CcoP1 in Pseudomonas stutzeri?

Pseudomonas stutzeri contains two independent ccoNO(Q)P operons encoding two cbb3 isoforms: Cbb3-1 and Cbb3-2 . While both CcoP1 and CcoP2 serve similar functions in their respective complexes, they exhibit structural and functional differences:

  • Heme coordination: Both CcoP variants contain c-type hemes, but spectroscopic characterization has revealed unique features. Notably, near-IR magnetic CD spectroscopy has identified the unexpected presence of a low-spin bishistidine-coordinated c-type heme in the CcoP subunit, which may have different coordination environments between the two variants .

  • Stability differences: Differential scanning calorimetry measurements have shown differences in the thermal stability between the two cbb3 isoforms, which may reflect structural differences in their respective CcoP subunits .

  • Interaction with CcoQ: The presence and interaction with the small subunit CcoQ differs between the two complexes. This interaction affects the stability of CcoP's incorporation into the complete complex .

  • Expression patterns: Under microaerobic growth conditions, the yield of pure Cbb3-1 was 6- to 8-fold higher than that of Cbb3-2, suggesting differential regulation and potentially different structural features that affect expression efficiency .

These structural differences likely contribute to the functional specialization of the two Cbb3 isoforms, allowing them to operate optimally under different environmental conditions.

What spectroscopic methods are most effective for characterizing CcoP2?

Several complementary spectroscopic techniques have proven particularly valuable for characterizing the structural and functional properties of CcoP2:

  • UV-visible spectroscopy: This fundamental technique identifies the characteristic absorption bands of the c-type hemes in CcoP2, providing information about their coordination and redox state. It allows researchers to monitor changes during purification and enzymatic reactions .

  • Magnetic Circular Dichroism (MCD): Near-IR MCD spectroscopy has been particularly valuable, revealing the unexpected presence of a low-spin bishistidine-coordinated c-type heme in the CcoP subunit. This technique provides detailed information about the electronic structure of the heme centers that cannot be obtained through UV-visible spectroscopy alone .

  • Electron Paramagnetic Resonance (EPR): X-band EPR spectroscopy of oxidized CcoP2 reveals distinct signals associated with the low-spin ferric hemes. By separately expressing the CcoP subunit in E. coli, researchers have been able to unambiguously assign each of the signals in the EPR spectrum to specific hemes, including those in CcoP2 .

  • Mass Spectrometry: This technique confirms the molecular weight of CcoP2 and can identify post-translational modifications and proper heme attachment. It has been used alongside other techniques to characterize purified cbb3 oxidases from P. stutzeri .

  • Differential Scanning Calorimetry: This method has been employed to assess and compare the thermal stability of the two cbb3 isoforms, providing insights into structural differences that may involve CcoP2 .

The combination of these spectroscopic approaches enables researchers to develop a comprehensive understanding of the structural and functional properties of CcoP2, particularly its heme centers that are crucial for electron transfer.

What is the role of heme groups in CcoP2 functionality?

The heme groups in CcoP2 are integral to its function as an electron transfer component. Detailed spectroscopic characterization has revealed important features about these prosthetic groups:

  • Heme types and coordination: CcoP2 contains c-type hemes that are covalently attached to the protein via thioether bonds. A combination of UV-visible and magnetic CD spectroscopies has clearly identified multiple low-spin hemes, including the unexpected presence of a low-spin bishistidine-coordinated c-type heme in the CcoP subunit .

  • Electron transfer pathway: These hemes form a crucial part of the electron transfer pathway from the donor cytochrome to the catalytic site in CcoN. The spatial arrangement and redox properties of these hemes are optimized for efficient electron transfer through the complex .

  • Spectroscopic signatures: Each heme in CcoP2 contributes distinct signals to the X-band EPR spectrum of the oxidized enzyme. By separately expressing CcoP in E. coli, researchers have been able to unambiguously assign each of the signals associated with low-spin ferric hemes in the spectrum .

  • Structural verification: The heme complement identified through spectroscopic analysis aligns well with the analysis of the primary sequence of the ccoNOPQ operon and biochemical analysis of the complex, confirming the predicted heme-binding motifs in CcoP2 .

The proper incorporation and coordination of these heme groups are essential for the assembly and function of the complete Cbb3-2 complex, as they provide the electron transfer capability that is fundamental to the respiratory function of the enzyme.

How is CcoP2 typically purified from recombinant expression systems?

Purification of recombinant CcoP2 requires specialized techniques due to its membrane protein nature and the presence of covalently attached heme groups. Based on successful approaches for the cbb3-type cytochrome c oxidase complexes, the following strategies have proven effective:

  • Expression system selection: For studying CcoP2 in the context of the complete Cbb3-2 complex, homologous expression in P. stutzeri strains has been successful. Researchers have created strains in which the genomic version of the respective operon was deleted, allowing expression of the recombinant version without interference from the native complex .

  • Affinity chromatography: Both cbb3 isoforms have been successfully purified separately by affinity chromatography. This typically involves adding affinity tags to one of the subunits of the complex .

  • Promoter optimization: The yield of Cbb3-2 (containing CcoP2) has been successfully increased to levels similar to Cbb3-1 by replacing its native promoter, demonstrating the importance of transcriptional regulation in controlling CcoP2 production .

  • Individual subunit expression: For studying CcoP2 independently, researchers have successfully expressed the subunit separately in E. coli. This approach allowed detailed spectroscopic characterization of CcoP without interference from other components of the complex .

  • Quality assessment: Multiple techniques including mass spectrometry, UV-visible spectroscopy, and differential scanning calorimetry are employed to verify the integrity and purity of the isolated CcoP2 or the complete Cbb3-2 complex .

These purification strategies have enabled detailed biochemical and spectroscopic characterization of CcoP2, both as part of the complete Cbb3-2 complex and as an individually expressed subunit.

Why is studying CcoP2 important for understanding bacterial energy metabolism?

Studying CcoP2 provides critical insights into bacterial energy metabolism, particularly under microaerobic conditions:

  • Adaptation to low oxygen environments: Cbb3-type oxidases, including the CcoP2-containing Cbb3-2 complex, are characterized by their high affinity for oxygen while retaining the ability to pump protons. These attributes are central to their proposed role in the microaerobic metabolism of proteobacteria .

  • Specialized respiratory chains: The presence of multiple terminal oxidases in bacteria like P. stutzeri, including two cbb3 isoforms, reflects the importance of respiratory flexibility for survival in environments with fluctuating oxygen concentrations .

  • Electron transfer mechanisms: Understanding the structure and function of CcoP2 helps elucidate the electron transfer pathways in bacterial respiratory chains, particularly how electrons are channeled from donors to the oxygen reduction site .

  • Evolutionary significance: Cbb3-type oxidases are found only in bacteria and play a primary role in microaerobic respiration, being essential for nitrogen-fixing endosymbionts and some human pathogens . This makes them interesting subjects for studying the evolution of respiratory systems.

  • Energy efficiency: Despite their high affinity for oxygen, cbb3-type oxidases retain the ability to pump protons, contributing to energy conservation through the generation of a proton motive force. Understanding CcoP2's role in this process helps explain how bacteria maximize energy yield under oxygen limitation .

Research on CcoP2 thus contributes to our fundamental understanding of bacterial bioenergetics and adaptation strategies, with potential implications for microbial ecology, pathogenesis, and biotechnology.

What are the challenges in expressing recombinant CcoP2 compared to other cytochrome subunits?

Expression of recombinant CcoP2 presents several unique challenges due to its structural complexity and functional integration with other subunits:

  • Heme incorporation: As a c-type cytochrome, CcoP2 requires proper incorporation of covalently attached heme groups. This necessitates a functional cytochrome c maturation system in the expression host, which can be limiting in heterologous expression systems .

  • Membrane protein expression: Being a membrane protein, CcoP2 requires proper insertion into the membrane for correct folding and function. This adds complexity to expression protocols compared to soluble proteins .

  • Interaction with other subunits: In its native context, CcoP2 forms specific interactions with other subunits of the complex, particularly CcoQ, which stabilizes its incorporation into the complete complex. The absence of these interaction partners during separate expression may affect stability .

  • Expression level regulation: Studies have shown that the yield of Cbb3-2 is naturally lower than that of Cbb3-1 under standard microaerobic growth conditions, suggesting intrinsic regulatory mechanisms that may affect recombinant expression .

  • Functional verification: Verifying the functionality of expressed CcoP2 requires specialized spectroscopic techniques to confirm proper heme incorporation and electronic properties .

Despite these challenges, successful strategies have been developed, including separate expression of CcoP in E. coli for spectroscopic characterization and increasing the yield of the complete Cbb3-2 complex by replacing its native promoter .

How does the presence of CcoQ affect the stability and integration of CcoP2 in the cbb3 complex?

The small subunit CcoQ plays a crucial role in the stability and proper integration of CcoP into the cbb3-type oxidase complex. Research findings highlight several important aspects of this interaction:

  • Stability of complex assembly: Blue native polyacrylamide gel electrophoresis analyses have revealed that the lack of CcoQ specifically impairs the stable recruitment of CcoP into the cbb3-type oxidase complex. This suggests a specific CcoQ-CcoP interaction that is essential for proper complex formation .

  • Confirmation through cross-linking: Chemical cross-linking experiments have confirmed the specific interaction between CcoQ and CcoP, providing direct evidence for their physical association .

  • Impact on enzyme activity: In the absence of CcoQ, cbb3-type oxidase activity is significantly reduced, irrespective of the growth conditions. This demonstrates the functional importance of the CcoQ-CcoP interaction for enzyme activity .

  • Membrane topology: CcoQ has been characterized as a single-spanning membrane protein with an Nout-Cin topology, which positions it appropriately for interaction with CcoP in the membrane environment .

  • Formation of active complex: The interaction between CcoQ and CcoP is required for the formation of the active 230-kDa cbb3-type oxidase complex. CcoQ stabilizes the interaction of CcoP with the CcoNO core complex, leading to the assembly of the complete, functional enzyme .

The specific interaction between CcoQ and CcoP thus represents a critical aspect of cbb3-type oxidase assembly and function, with CcoQ serving as an assembly factor that ensures proper incorporation of CcoP into the complex.

How do specific mutations in CcoP2 affect the electron transfer pathway in the Cbb3-type cytochrome c oxidase complex?

Investigating the effects of specific mutations in CcoP2 provides valuable insights into the electron transfer mechanisms within the Cbb3-2 complex. Methodological approaches to address this question include:

  • Heme coordination mutants: Targeted mutations of histidine residues coordinating the hemes in CcoP2 can disrupt specific points in the electron transfer pathway. Spectroscopic techniques like EPR and UV-visible spectroscopy can then be used to monitor changes in the electronic properties of the hemes and correlate these with functional effects on electron transfer and oxygen reduction .

  • Interface residue mutations: Modifying amino acids at the interface between CcoP2 and other subunits, particularly CcoQ, can affect the stability of CcoP2 incorporation into the complex. Blue native PAGE analysis can reveal changes in complex assembly, while activity assays can measure the functional consequences .

  • Kinetic analysis: Comparing electron transfer rates and oxygen reduction activity between wild-type and mutant complexes reveals functional impacts. The high turnover of at least 2,000 electrons s⁻¹ and high Michaelis-Menten constant (Km ∼ 3.6 mM) reported for P. stutzeri cbb3-CcOs can serve as benchmarks for evaluating the effects of mutations .

  • Thermal stability assessment: Differential scanning calorimetry can be used to determine how mutations affect the thermal stability of the complex, providing insights into structural perturbations that may impact electron transfer efficiency .

  • Comparative analysis: Creating equivalent mutations in both CcoP1 and CcoP2 allows researchers to identify isoform-specific effects, potentially explaining the functional specialization of the two cbb3 complexes in P. stutzeri .

Through systematic mutational analysis, researchers can map the electron transfer pathway through CcoP2 and understand how specific residues contribute to the efficiency and regulation of this process, ultimately advancing our understanding of how these specialized bacterial oxidases function.

What are the methodological approaches for studying the interaction between CcoP2 and CcoQ in Pseudomonas stutzeri?

The interaction between CcoP2 and CcoQ is crucial for the stability and optimal activity of the Cbb3-2 complex. Several complementary methodological approaches can be used to characterize this interaction:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates protein complexes in their native state, allowing comparison of complex formation in wild-type versus ΔccoQ strains. Research has shown that lack of CcoQ specifically impairs the stable recruitment of CcoP into the cbb3-type oxidase complex, demonstrating the importance of this interaction for complex assembly .

  • Chemical cross-linking: Bifunctional cross-linking agents can be used to covalently link interacting proteins, followed by mass spectrometric analysis to identify interaction sites. This approach has successfully confirmed the specific CcoQ-CcoP interaction in studies with R. capsulatus and can be adapted for P. stutzeri CcoP2 .

  • Functional assays with mutants: Creating mutations in potential interaction sites and measuring their effects on complex assembly and activity can identify critical residues for the CcoP2-CcoQ interaction. In the absence of CcoQ, cbb3-type oxidase activity is significantly reduced, providing a functional readout for successful interaction .

  • Co-expression studies: Co-expressing tagged versions of CcoP2 and CcoQ and performing co-purification experiments can confirm their direct interaction and identify conditions that affect complex formation.

  • Structural prediction and validation: Using computational modeling based on known structures of related proteins, followed by experimental validation of predicted interaction surfaces through targeted mutations.

These approaches can reveal the molecular basis of the CcoP2-CcoQ interaction in P. stutzeri, which has been shown to be essential for the formation of the active 230-kDa cbb3-type oxidase complex by stabilizing the interaction of CcoP with the CcoNO core complex .

What experimental strategies can be employed to compare the kinetic properties of CcoP2 versus CcoP1 in reconstituted systems?

Comparing the kinetic properties of CcoP2 and CcoP1 requires careful experimental design to ensure fair comparison while revealing meaningful functional differences:

  • Purification and reconstitution strategies:

    • Express and purify both CcoP variants using identical tags and protocols

    • Reconstitute each into liposomes with defined lipid composition

    • Alternatively, reconstitute each with identical CcoN/CcoO subunits to form complete complexes

    • Verify comparable incorporation using protein quantification and spectroscopic methods

  • Oxygen reduction kinetics:

    • Measure oxygen consumption rates using an oxygen electrode

    • Determine Km values for oxygen (both isoforms are expected to have high oxygen affinity)

    • Calculate Vmax values and turnover numbers

    • The high turnover of at least 2,000 electrons s⁻¹ and high Michaelis-Menten constant (Km ∼ 3.6 mM) reported for P. stutzeri cbb3-CcOs using ascorbate-TMPD can serve as a benchmark

  • Electron transfer from different donors:

    • Compare rates with physiological electron donors and artificial donors like ascorbate/TMPD

    • Determine if the two variants show preferences for different electron donors

    • Measure binding affinities and electron transfer rates from various donors

  • Stability comparisons:

    • Use differential scanning calorimetry to compare thermal stability

    • Assess long-term activity retention under various conditions

    • Determine stability in the presence and absence of CcoQ

  • Proton pumping measurements:

    • Compare proton pumping efficiency (H⁺/e⁻ ratio) between the two variants

    • Determine whether differences in CcoP affect the coupling between electron transfer and proton translocation

These comparative studies will reveal whether the two CcoP variants confer different kinetic properties to their respective Cbb3 complexes, potentially explaining why P. stutzeri maintains two distinct cbb3 isoforms and expresses them under different conditions .

How can researchers effectively study the membrane topology and insertion mechanisms of recombinant CcoP2?

Understanding the membrane topology and insertion mechanisms of CcoP2 requires specialized techniques for membrane protein analysis:

  • Fusion protein reporters for topology mapping:

    • Create fusion constructs with topology reporters at different positions

    • Analyze reporter signals to determine which portions of the protein are exposed to different cellular compartments

    • Based on studies with R. capsulatus, where CcoQ has been shown to have an Nout-Cin topology, similar approaches can be applied to CcoP2

  • Protease accessibility studies:

    • Treat purified membranes or proteoliposomes with proteases

    • Analyze protected fragments by mass spectrometry or immunoblotting

    • Map regions embedded in the membrane versus exposed loops

  • Spectroscopic analysis of heme environments:

    • The spectroscopic properties of the hemes in CcoP2, particularly the distinct signatures in UV-visible and MCD spectra, provide information about their location within the membrane environment

    • Compare spectra of detergent-solubilized versus membrane-embedded CcoP2 to identify environment-dependent changes

  • Co-expression with assembly factors:

    • Investigate whether specific assembly factors are required for proper insertion of CcoP2

    • Study the role of CcoQ in stabilizing the correct topology of CcoP2 in the membrane

  • Cysteine accessibility scanning:

    • Introduce cysteine residues at different positions

    • Use membrane-impermeable thiol-reactive reagents to determine accessibility

    • Map the topology based on reactivity patterns

  • Computational prediction and validation:

    • Use topology prediction algorithms as a starting point

    • Validate predictions with experimental data

    • Build refined models incorporating constraints from spectroscopic and biochemical data

These approaches can reveal the precise membrane topology of CcoP2 and provide insights into how this complex cytochrome with multiple heme groups is properly inserted and oriented in the bacterial membrane, contributing to our understanding of membrane protein assembly in bacterial respiratory complexes.

What are the physiological implications of the different expression patterns of Cbb3-1 versus Cbb3-2 in Pseudomonas stutzeri?

The differential expression of the two cbb3 isoforms in P. stutzeri suggests distinct physiological roles, which can be investigated through several approaches:

  • Quantitative expression analysis:

    • Under microaerobic growth conditions, the yield of pure Cbb3-1 was 6- to 8-fold higher than that of Cbb3-2, indicating differential regulation

    • Researchers have successfully increased the yield of Cbb3-2 to similar levels as Cbb3-1 by replacing its native promoter, demonstrating the importance of transcriptional regulation

    • Systematic analysis of expression patterns under various oxygen tensions and other environmental conditions can reveal the specific niches for each isoform

  • Functional specialization studies:

    • Compare oxygen affinities, electron transfer rates, and proton pumping efficiencies

    • Despite structural differences, no significant functional differences in oxygen reductase and catalase activities were observed in initial comparisons

    • More detailed kinetic analyses and studies under physiologically relevant conditions may reveal subtle functional specializations

  • Adaptation to environmental stressors:

    • Investigate whether the two isoforms show different responses to environmental stressors beyond oxygen limitation

    • Test performance under various pH values, temperatures, and in the presence of inhibitors or competing terminal electron acceptors

  • Growth phenotypes of mutant strains:

    • Create strains expressing only one isoform and compare growth under various conditions

    • Measure competitive fitness of strains with different isoform expression patterns

  • Evolutionary conservation analysis:

    • Compare the conservation patterns of the two operons across Pseudomonas species

    • Identify whether certain environmental niches correlate with the presence of specific isoforms

Understanding the physiological implications of these different expression patterns will provide insights into how bacteria optimize their respiratory chains for different environmental conditions, representing a sophisticated adaptation strategy for energy metabolism in variable environments.

How does cytochrome c oxidase dysfunction contribute to oxidative stress, and what lessons can be applied to studying CcoP2?

Cytochrome c oxidase (CcO) dysfunction has been linked to increased oxidative stress in various biological systems, providing important context for studying CcoP2:

Lessons from studies on mammalian CcO dysfunction can guide research on bacterial systems, while recognizing the unique features of cbb3-type oxidases like their high oxygen affinity and specialized subunit composition including CcoP2 .

What are the methodological considerations for studying CcoP2 under varying oxygen concentrations that mimic microaerobic conditions?

Studying CcoP2 function under physiologically relevant microaerobic conditions requires specialized techniques:

  • Controlled microaerobic environments:

    • Use specialized bioreactors with precise oxygen control

    • Implement feedback systems using oxygen sensors to maintain stable microaerobic conditions

    • Create oxygen gradients using diffusion-based systems

    • These approaches are essential since cbb3-type oxidases are characterized by their high affinity for oxygen and play a primary role in microaerobic respiration

  • Gene expression analysis:

    • Monitor ccoP2 expression levels at different oxygen concentrations

    • Compare with ccoP1 expression to understand the differential regulation

    • This is particularly important given the observation that under microaerobic growth conditions, the yield of pure Cbb3-1 was 6- to 8-fold higher than that of Cbb3-2

  • Adaptation of activity assays:

    • Develop assays that function reliably at low oxygen tensions

    • Consider the high oxygen affinity of these enzymes when designing experiments

    • Account for the high turnover rate (at least 2,000 electrons s⁻¹) and high Michaelis-Menten constant (Km ∼ 3.6 mM) when using ascorbate-TMPD as electron donor

  • Spectroscopic techniques under low oxygen:

    • Modify standard spectroscopic setups to maintain defined oxygen levels

    • Use rapid-mixing devices combined with spectroscopic detection for transient measurements

    • These adaptations are necessary for studying the c-type hemes in CcoP2 under conditions that mimic their native environment

  • Comparative analysis of isoforms:

    • Compare the properties of CcoP2-containing Cbb3-2 with CcoP1-containing Cbb3-1 under identical microaerobic conditions

    • Identify oxygen concentration thresholds where functional differences become apparent

These methodological considerations are crucial for accurately assessing the function of CcoP2 under the microaerobic conditions where cbb3-type oxidases play their most important physiological roles as key components in bacterial adaptation to environments with limited oxygen availability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.