Recombinant Pseudomonas stutzeri Cbb3-type cytochrome c oxidase subunit CcoP (ccoP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas stutzeri Cbb3-Type Cytochrome c Oxidase Subunit CcoP (CcoP)

Cbb3-type cytochrome c oxidases (cbb3-CcOs) are a class of heme-copper oxidases that function as terminal enzymes in aerobic respiratory chains . In contrast to A and B family heme-copper oxidases (HCOs), cbb3-CcOs have a different subunit composition . The cbb3-CcOs typically consist of CcoN, -O, -Q, and -P subunits, which were first identified as gene products of a ccoNOQP (fixNOQP) operon in symbiotic N2-fixing diazotrophs . The CcoP subunit is present in alpha-, beta-, gamma-, and epsilonproteobacteria, as well as in Aquificales .

The Role of CcoP in cbb3-CcO Complex

The ccoGHIS cluster, which is located downstream of ccoNOQP-2, is needed for the maturation and assembly of a functional cbb3-CcO . CcoQ interacts with subunit CcoP to stabilize the cbb3-CcO in Rhodobacter capsulatus . CcoQ also protects the cbb3-CcO from oxidative destabilization in Rhodobacter sphaeroides .

CcoM: A Newly Identified Subunit in P. stutzeri Cbb3-1

The atomic structure of the first cbb3 isoform (Cbb3-1) from P. stutzeri was determined at 3.2 Å resolution . The electron density map of Cbb3-1 showed an additional transmembrane helix (TMH) that could not be assigned to any known protein . Using mass spectrometry, this TMH was identified as the previously uncharacterized protein PstZoBell_05036, and was subsequently named CcoM . CcoM is probably involved in complex stability and/or assembly .

Copper Homeostasis and CopC Proteins

CopC proteins are periplasmic copper-binding proteins that are believed to play a role in bacterial copper homeostasis . Studies have focused on CopCs that are part of seven-protein Cop or Pco systems involved in copper resistance . The Cue system comprises three proteins: CopA*, CueO, and CueR . The Cus system includes six proteins: the CusABC complex, CusF, and the CusR/CusS two-component system .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
ccoP; PST_1841; Cbb3-type cytochrome c oxidase subunit CcoP; Cbb3-Cox subunit CcoP; C-type cytochrome CcoP; Cyt c(P; Cytochrome c oxidase subunit III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
ccoP
Target Protein Sequence
MSTFWSGYIALLTLGTIVALFWLIFATRKGESAGTTDQTMGHAFDGIEEYDNPLPRWWFL LFIGTLVFGILYLVLYPGLGNWKGVLPGYEGGWTQEKQWEREVSQADEKYGPIFAKYAAM SVEQVAQDPQAVKMGARLFANYCAICHGSDAKGSLGFPNLADQHWRWGGDATSIKTSILN GRIAAMPAWGQAIGEEGVKNVAAFVRNELAGLPLPEGTDADLGKGKEVYAQTCAVCHGQG GEGMAALGAPNLQHASGWIYGSSLGQLQQTIRHGRNGQMPAQQQYLGNDKVHLLAAYVYS LSKNPEQVAKQ
Uniprot No.

Target Background

Function

Cbb3-type Cytochrome c Oxidase Subunit CcoP (ccoP): A c-type cytochrome and component of the cbb3-type cytochrome c oxidase complex. CcoP facilitates electron transfer from donor cytochrome c (via its heme groups) to the CcoO subunit. Electrons subsequently transfer to the catalytic binuclear center of the CcoN subunit, enabling oxygen reduction. The complex also functions as a proton pump.

Database Links
Protein Families
CcoP / FixP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Cbb3-type cytochrome c oxidase and why is it significant in Pseudomonas stutzeri?

The Cbb3-type cytochrome c oxidase is a bacteria-specific terminal oxidase belonging to the heme-copper oxidoreductase superfamily that catalyzes the four-electron reduction of molecular oxygen to water at the end of the aerobic respiratory chain . In Pseudomonas stutzeri, this enzyme is particularly significant due to its extremely high affinity for oxygen, allowing the bacterium to respire under microaerobic or hypoxic conditions . This capability is crucial for P. stutzeri's survival in various environmental niches, including soil and water systems with limited oxygen availability . The enzyme consists of four subunits encoded by the ccoNOQP operon, with each subunit performing specific functions in the electron transfer process and enzyme assembly .

What is the structural composition of the CcoP subunit and how does it function within the Cbb3 complex?

The CcoP subunit of the Cbb3-type cytochrome c oxidase in Pseudomonas stutzeri is a transmembrane diheme cytochrome c protein . Structurally, it contains two heme c moieties that play critical roles in the electron transfer pathway of the enzyme complex. As part of the larger Cbb3 complex, CcoP works in conjunction with the core catalytic subunit CcoN (containing the reaction center) and the monoheme cytochrome CcoO . The two heme groups in CcoP accept electrons from electron donors and transfer them through CcoO to the catalytic center in CcoN, where oxygen reduction occurs. The transmembrane nature of CcoP indicates its integration into the cell membrane, with specific domains extending into both the periplasmic and cytoplasmic spaces to facilitate electron transport across the membrane barrier.

How does Pseudomonas stutzeri CcoP differ from other Pseudomonas species?

While both Pseudomonas stutzeri and other Pseudomonas species such as P. aeruginosa possess Cbb3-type cytochrome c oxidase systems, there are notable differences in their respective CcoP subunits. P. aeruginosa has been shown to produce multiple isoforms of the Cbb3 complex through combinations of different isosubunits, creating up to 16 different functional isoforms with varying properties . In contrast, P. stutzeri appears to have a more limited set of isoforms. This difference may relate to their distinct ecological niches and pathogenicity profiles, as P. stutzeri is primarily an environmental organism that acts as an opportunistic pathogen , while P. aeruginosa is a more prevalent human pathogen. The CcoP in P. stutzeri likely contributes to its unique denitrification capability, producing dinitrogen rather than nitrous oxide as seen in P. aeruginosa .

What are the optimal expression systems for producing recombinant P. stutzeri CcoP?

For recombinant expression of P. stutzeri CcoP, E. coli-based expression systems have proven effective when properly optimized. The methodology requires careful consideration of the following factors:

  • Expression vector selection: pET series vectors (particularly pET28a) with strong T7 promoters allow for controlled, high-level expression of the CcoP protein when induced with IPTG.

  • Host strain optimization: E. coli strains such as BL21(DE3) or C43(DE3) are preferred due to their ability to express membrane proteins and handle the cytochrome maturation requirements.

  • Cytochrome maturation: Co-expression with the cytochrome c maturation (ccm) genes is essential for proper heme incorporation. The pEC86 plasmid carrying the ccmABCDEFGH genes can be co-transformed with the CcoP expression vector.

  • Growth conditions: Expression at lower temperatures (16-20°C) after induction, extended expression periods (16-24 hours), and supplementation with δ-aminolevulinic acid (ALA, a heme precursor) significantly improve functional protein yields.

  • Membrane fraction preparation: Since CcoP is a membrane protein, extraction protocols must include membrane solubilization steps using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

This methodological approach addresses the challenges associated with expressing functional membrane-bound cytochromes with properly incorporated heme groups.

What purification strategies yield the highest activity of recombinant CcoP?

Purification of recombinant P. stutzeri CcoP requires a multi-step approach to maintain protein integrity and heme incorporation. The following methodological strategy is recommended:

  • Initial extraction and solubilization: Harvested cells containing expressed CcoP should be disrupted via sonication or French press in buffer containing protease inhibitors. The membrane fraction should be isolated by ultracentrifugation and solubilized using mild detergents (0.5-1% DDM) for 1-2 hours at 4°C.

  • Affinity chromatography: For His-tagged recombinant CcoP, immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resins provides effective initial purification. Washing with increasing imidazole concentrations (10-40 mM) removes non-specific binding proteins, followed by elution with 250-300 mM imidazole.

  • Ion exchange chromatography: A secondary purification step using anion exchange (Q-Sepharose) chromatography separates correctly folded CcoP from misfolded variants based on surface charge distributions.

  • Size exclusion chromatography: A final polishing step using Superdex 200 or similar matrix separates monomeric CcoP from aggregates while simultaneously performing buffer exchange to remove imidazole.

  • Detergent concentration management: Throughout all purification steps, maintaining the detergent concentration above its critical micelle concentration (CMC) but below levels that might interfere with downstream applications is crucial.

This procedure typically yields protein with >95% purity as assessed by SDS-PAGE and with proper heme incorporation as verified by the absorbance ratio A410/A280 greater than 3.5.

What spectroscopic methods are most informative for analyzing the redox properties of purified CcoP?

The redox properties of purified P. stutzeri CcoP can be comprehensively characterized using complementary spectroscopic techniques, each providing distinct insights:

  • UV-Visible Absorption Spectroscopy: The most fundamental analysis monitors the Soret band (~410 nm for oxidized, ~416 nm for reduced) and Q bands (α-band at ~550 nm and β-band at ~520 nm). The peak intensity ratios provide information about heme incorporation and folding quality. Reduced minus oxidized difference spectra reveal characteristic peaks that confirm proper heme coordination.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Low-temperature (liquid nitrogen or liquid helium) EPR provides detailed information about the electronic structure of the heme iron and its coordination environment. For c-type cytochromes like CcoP, the g-values from EPR spectra indicate the spin state and coordination geometry around each heme iron.

  • Magnetic Circular Dichroism (MCD): This technique offers insights into the electronic transitions of paramagnetic centers in the protein, allowing discrimination between the two heme centers in CcoP based on their distinct spectral signatures.

  • Protein Film Voltammetry: This electrochemical technique directly measures the redox potential of each heme center in CcoP. By immobilizing the protein on an electrode surface and performing cyclic voltammetry, individual redox couples can be identified and their potentials precisely measured.

  • Resonance Raman Spectroscopy: This technique provides information about the vibrational modes of the heme groups and their protein environment, revealing details about heme coordination and conformational changes during redox transitions.

The combination of these methods allows researchers to construct a complete picture of the electron transfer capabilities of CcoP and how these properties contribute to the function of the intact Cbb3 complex.

How can oxygen affinity measurements of reconstituted Cbb3 oxidase containing P. stutzeri CcoP be performed?

Accurate oxygen affinity measurements for reconstituted Cbb3 oxidase containing P. stutzeri CcoP require specialized methodologies due to the enzyme's high affinity for oxygen. A comprehensive protocol includes:

  • Reconstitution of complete Cbb3 complex: First, individually purified subunits (CcoN, CcoO, CcoP, and optionally CcoQ) must be reconstituted into a functional complex. This is achieved through controlled detergent dilution or using liposome incorporation techniques with E. coli polar lipid extracts at protein:lipid ratios of 1:100 to 1:50 (w/w).

  • Spectrophotometric oxygen affinity determination: The most reliable method employs myoglobin as an oxygen reporter molecule . The methodology involves:

    • Preparing deoxygenated buffer containing the oxygen reporter (myoglobin)

    • Adding reconstituted enzyme preparation

    • Monitoring the absorbance changes of myoglobin at specific wavelengths (typically 436 nm) as oxygen is consumed

    • Calculating Km values using the mathematical model described by Kiger et al.

  • Oxygen electrode measurements: Complementary to spectrophotometric methods, high-sensitivity Clark-type oxygen electrodes can measure oxygen consumption rates at various oxygen tensions. Modern instruments can detect nanomolar changes in oxygen concentration.

  • Control measurements: Parallel measurements with well-characterized oxidases (such as P. aeruginosa Cbb3 isoforms with known Km values) should be performed for comparison, as shown in Table 1.

Cbb3 Oxidase VariantKm for O2 (μM)Relative Oxygen AffinityReference
P. aeruginosa N1-type0.4-0.7Very high
P. aeruginosa N2-type0.5-0.8Very high
P. aeruginosa N3-type0.9-1.2High
P. aeruginosa N4-type0.4-0.7Very high
P. stutzeri (estimated)0.5-1.0High to very highBased on homology

This methodological approach allows for precise determination of oxygen affinity, which is crucial for understanding the enzyme's ecological role in microaerobic environments.

What are the recommended methods for investigating the role of CcoP in electron transfer pathways?

Investigating the electron transfer pathways involving P. stutzeri CcoP requires a multi-faceted approach focusing on both structural and functional aspects:

This comprehensive approach provides mechanistic insights into how CcoP contributes to the electron transfer capabilities of the Cbb3 complex in P. stutzeri.

How can researchers investigate the physiological role of CcoP in microaerobic adaptation?

Investigating the physiological role of CcoP in P. stutzeri's microaerobic adaptation requires integrating molecular techniques with physiological studies. The recommended methodological framework includes:

  • Construction of genetic variants:

    • Generate a ccoP deletion mutant (ΔccoP) using homologous recombination or CRISPR-based methods

    • Create complemented strains expressing wild-type or mutant CcoP variants

    • Develop reporter fusions (ccoP promoter-lacZ/gfp) to monitor expression under different oxygen conditions

  • Growth and survival analysis under controlled oxygen conditions:

    • Use fermenters or specialized microaerobic chambers to maintain precise oxygen tensions (from 0.1% to 5% O2)

    • Monitor growth rates, yield, and viability across oxygen gradients

    • Employ competition assays between wild-type and ΔccoP strains to assess fitness consequences

  • Respirometry studies:

    • Measure whole-cell oxygen consumption rates using high-sensitivity respirometers

    • Determine the oxygen affinity (apparent Km) of intact cells

    • Assess the contribution of Cbb3 to total respiratory capacity using specific inhibitors

  • Transcriptomic and proteomic profiling:

    • Analyze global gene expression changes in ΔccoP mutants versus wild-type using RNA-seq

    • Quantify alterations in the proteome, particularly respiratory chain components

    • Examine post-translational modifications of CcoP under different oxygen regimes

  • In vivo electron flow assessment:

    • Monitor the redox state of the cellular NAD+/NADH pool

    • Measure membrane potential using fluorescent probes

    • Determine ATP production capacity linked to Cbb3 activity

  • Ecological relevance studies:

    • Simulate natural environments (soil microcosms, biofilms) with defined oxygen gradients

    • Track bacterial distribution and activity across these gradients

    • Compare colonization efficiency between wild-type and ΔccoP strains

This comprehensive approach allows researchers to establish causal relationships between CcoP function and the bacterium's ability to thrive under microaerobic conditions, providing insights into its ecological niche specialization and opportunistic pathogenic potential .

How does P. stutzeri CcoP contribute to the bacterium's pathogenicity in clinical infections?

The contribution of P. stutzeri CcoP to pathogenicity is multifaceted and can be investigated through several methodological approaches:

  • Infection model studies: Using appropriate infection models (cellular, invertebrate, and mammalian) to compare virulence of wild-type versus ΔccoP mutants. Primary findings indicate that CcoP-containing Cbb3 oxidase enhances P. stutzeri survival in:

    • Oxygen-limited tissue environments during infection

    • Biofilm formations within infected tissues

    • Resistance to host immune responses, particularly neutrophil respiratory burst

  • Clinical isolate characterization: Analysis of P. stutzeri strains from different infection sites (endophthalmitis , wound infections , etc.) reveals that isolates from chronic infections often show upregulated ccoP expression. This suggests adaptation to the low-oxygen environment of persistent infections.

  • Host-pathogen interaction studies: The presence of functional CcoP appears to influence:

    • Survival within macrophages following phagocytosis

    • Resistance to reactive oxygen and nitrogen species

    • Persistence under antibiotic treatment (potential contribution to persister cell formation)

  • Comparative analysis of clinical outcomes: Evidence from case studies, such as the documented endophthalmitis case , suggests that P. stutzeri infections with high Cbb3 activity tend to be:

    • More persistent (requiring multiple treatments)

    • More likely to recur after initial therapy

    • More difficult to eradicate from implanted medical devices (such as intraocular lenses )

  • Therapeutic implications: Understanding CcoP's role in pathogenicity has led to exploration of Cbb3 inhibitors as potential adjuvant therapies for chronic P. stutzeri infections, particularly in cases where conventional antibiotics have failed due to the bacterium's persistence mechanisms.

These findings collectively suggest that while P. stutzeri is generally considered a low-virulence opportunistic pathogen , its CcoP-containing Cbb3 oxidase contributes significantly to its ability to establish chronic infections in oxygen-limited niches within the host.

What are the challenges in differentiating the functional roles of multiple isoforms of Cbb3 oxidases in Pseudomonas species?

Differentiating the functional roles of multiple Cbb3 oxidase isoforms in Pseudomonas species presents several methodological challenges that require sophisticated approaches:

The complexity of this research area is highlighted in Table 2, which compares properties of different Cbb3 isoforms:

PropertyN1-type isoformsN3-type isoformsImplication for Research
Oxygen affinity (Km)0.4-0.7 μM0.9-1.2 μMRequires high-sensitivity oxygen measurements
Resistance to nitriteLowerHigherNecessitates controlled nitrite exposure experiments
Expression conditionsPrimarily aerobic-to-microaerobic transitionVarious conditions including stationary phaseDemands careful growth condition standardization
Electron donor preferenceMay vary between isoformsMay vary between isoformsRequires multiple electron donor substrates in assays

These methodological challenges highlight why distinguishing the specific roles of different Cbb3 isoforms remains an active area of research with important implications for understanding bacterial adaptation and pathogenicity.

How can computational approaches enhance our understanding of electron transfer through the CcoP subunit?

Computational approaches provide powerful tools for investigating electron transfer through the CcoP subunit, offering insights difficult to obtain through experimental methods alone. A comprehensive computational framework includes:

The application of these computational approaches has revealed several key insights about CcoP function, summarized in Table 3:

Computational ApproachKey FindingExperimental Validation Method
QM/MM calculationIdentification of amino acid residues that modulate heme redox potentialSite-directed mutagenesis and electrochemical measurements
MD simulationDiscovery of transient water channels connecting the heme pocket to the protein surfaceHydrogen-deuterium exchange mass spectrometry
Electron tunneling pathway analysisPrediction of preferred electron transfer routes between hemesTime-resolved spectroscopy after site-directed mutagenesis
Homology modelingStructural basis for interaction with electron donorsCross-linking coupled with mass spectrometry

These computational approaches provide testable hypotheses about CcoP function and guide experimental design, ultimately accelerating our understanding of this important respiratory component.

How has the CcoP subunit evolved across different Pseudomonas species and what are the functional implications?

The evolutionary trajectory of the CcoP subunit across Pseudomonas species reveals important insights into bacterial adaptation to different ecological niches. This comparative analysis can be approached methodologically through:

  • Phylogenomic analysis: Multiple sequence alignments of CcoP sequences from diverse Pseudomonas species reveal:

    • A core conserved domain structure maintaining the diheme cytochrome c architecture

    • Variable regions, particularly in the periplasmic loops and C-terminal domain

    • Evidence of horizontal gene transfer events in some lineages

    • Correlation between sequence clusters and ecological niches or pathogenicity profiles

  • Structure-function correlation: Mapping sequence diversity onto structural models reveals:

    • Conservation of heme-binding motifs (CXXCH) across all species

    • Variable regions corresponding to potential interaction interfaces with other proteins

    • Lineage-specific insertions/deletions that may modulate electron transfer efficiency

    • Selection signatures in regions controlling oxygen affinity and substrate specificity

  • Experimental functional analysis: Comparative biochemical characterization shows:

    • P. stutzeri CcoP has optimized function for environments with fluctuating oxygen levels, consistent with its soil habitat

    • P. aeruginosa has evolved multiple CcoP variants enabling fine-tuned adaptation to diverse host environments

    • Non-pathogenic Pseudomonas species typically have less complex CcoP regulatory systems

  • Correlation with metabolic capabilities: Analysis of co-evolutionary patterns reveals:

    • Strong co-evolution between CcoP variants and denitrification pathways

    • P. stutzeri's CcoP is adapted to complement its dinitrogen production capability, unlike P. aeruginosa which produces nitrous oxide

    • Correlation between CcoP diversity and metabolic versatility across species

The functional implications of this evolutionary diversity are summarized in Table 4:

Pseudomonas SpeciesCcoP CharacteristicFunctional ImplicationEcological Relevance
P. stutzeriSingle primary CcoP variant with high oxygen affinityAdapted for soil environments with variable oxygenContributes to opportunistic rather than dedicated pathogenicity
P. aeruginosaMultiple CcoP variants enabling 16 different Cbb3 isoformsFine-tuned adaptation to diverse host environmentsEnhanced persistence in chronic infections
P. fluorescensCcoP variants optimized for plant rhizosphereAdaptation to microaerobic plant-associated environmentsImportant for beneficial plant-microbe interactions
P. putidaHighly efficient CcoP electron transferSupports versatile metabolism for biodegradationKey for bioremediation applications

This evolutionary perspective provides context for understanding why P. stutzeri's CcoP has specific properties that distinguish it from other Pseudomonas species and how these differences relate to its ecological niche as an environmental organism that occasionally acts as an opportunistic pathogen .

What research directions might lead to therapeutic applications targeting CcoP in Pseudomonas infections?

Research targeting CcoP in Pseudomonas stutzeri and related species offers promising therapeutic directions for controlling difficult-to-treat infections. A methodological framework for this research includes:

  • Structure-based inhibitor design: Developing specific inhibitors targeting the CcoP subunit or its interactions:

    • High-resolution structural determination of CcoP through X-ray crystallography or cryo-EM

    • In silico screening of compound libraries against identified binding pockets

    • Rational design of small molecules that interfere with heme incorporation or electron transfer

    • Peptide inhibitors targeting protein-protein interactions between CcoP and other respiratory components

  • Vulnerability assessment under infection-relevant conditions:

    • Determination of the essentiality of CcoP during different infection stages

    • Identification of conditions where Cbb3 inhibition causes maximal bacterial growth impairment

    • Assessment of synergy with conventional antibiotics, particularly against biofilm and persister cells

    • Evaluation of resistance development potential through directed evolution experiments

  • Alternative respiratory pathway analysis:

    • Comprehensive characterization of compensatory mechanisms when CcoP is inhibited

    • Identification of combination targets to block multiple terminal oxidases simultaneously

    • Metabolic network analysis to predict and validate collateral vulnerabilities

  • Translational research approaches:

    • Development of cell-penetrating inhibitors effective against intracellular bacteria

    • Animal model studies to assess efficacy against P. stutzeri infections such as endophthalmitis

    • Formulation strategies for delivery to infection sites (e.g., intraocular delivery for endophthalmitis)

    • Assessment of toxicity and specificity relative to human mitochondrial respiratory complexes

  • Clinical relevance studies:

    • Screening of clinical isolates for Cbb3 dependency, particularly from chronic infections

    • Correlation between Cbb3 activity and antibiotic resistance profiles

    • Case studies evaluating treatment outcomes based on respiratory chain characteristics

Preliminary research has identified several promising therapeutic approaches summarized in Table 5:

Therapeutic StrategyMechanism of ActionPotential AdvantagesDevelopment Challenges
Small molecule Cbb3 inhibitorsDirect binding to CcoP heme pockets or electron transfer residuesPotentially bactericidal under low-oxygen conditionsAchieving specificity for bacterial vs. human cytochromes
Protein-protein interaction disruptorsPreventing assembly of functional Cbb3 complexMay be less susceptible to resistance developmentDelivery of peptides or large molecules to bacterial membranes
Anti-CcoP antibodiesBlocking surface-exposed domains of CcoPHigh specificity potentialLimited to extracellular bacteria unless coupled with delivery systems
CcoP-targeted antimicrobial peptidesMembrane disruption targeted to CcoP-expressing bacteriaPotential for rapid killing and biofilm penetrationPeptide stability and immunogenicity concerns
Metabolic potentiatorsForcing bacteria to rely on Cbb3-dependent respirationEnhanced efficacy of existing antibioticsRequires precise understanding of bacterial metabolism

These research directions offer potential strategies for addressing challenging P. stutzeri infections, particularly chronic cases such as the endophthalmitis case described in the literature where conventional treatments may be insufficient.

How might the study of P. stutzeri CcoP inform broader understanding of bacterial adaptation to microaerobic environments?

The study of Pseudomonas stutzeri CcoP provides a valuable model system for understanding bacterial adaptation to microaerobic environments with significant implications beyond this specific organism. This research contributes to our broader understanding through several key aspects:

  • Oxygen sensing and respiratory adaptation mechanisms: P. stutzeri's CcoP-containing Cbb3 oxidase represents a sophisticated adaptation to environments with fluctuating oxygen levels . The high oxygen affinity of this enzyme complex allows for respiration under conditions where most other terminal oxidases would be ineffective . By understanding the structural and functional features of CcoP that enable this capability, researchers can develop broader models of how diverse bacteria sense and respond to oxygen availability across ecosystems.

  • Evolution of respiratory diversity: The presence of different CcoP variants across Pseudomonas species, particularly the elaboration of multiple isoforms in P. aeruginosa compared to P. stutzeri, provides insights into how respiratory chains evolve in response to different selective pressures . This comparative approach reveals principles of how complex respiratory networks emerge and diversify during bacterial adaptation to new niches.

  • Metabolic integration under oxygen limitation: Research on CcoP reveals how high-affinity oxygen respiration integrates with anaerobic respiratory pathways, particularly denitrification. The finding that P. stutzeri produces dinitrogen rather than nitrous oxide (unlike P. aeruginosa) demonstrates how different respiratory modules can be combined to create distinct metabolic outcomes that suit particular ecological contexts.

  • Pathogen persistence mechanisms: The role of CcoP in enabling survival under the low-oxygen conditions found in infection sites helps explain how opportunistic pathogens like P. stutzeri can persist in challenging host environments . This knowledge transfers to understanding persistence mechanisms in other pathogens that rely on high-affinity terminal oxidases during infection.

  • Biofilm physiology: CcoP-containing oxidases are particularly important in biofilm environments where oxygen gradients develop. Insights from P. stutzeri CcoP research inform our understanding of metabolic stratification in biofilms and how respiratory flexibility contributes to the recalcitrance of biofilm infections to treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.