Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas stutzeri Cobalamin Biosynthesis Protein CobD

Recombinant Pseudomonas stutzeri Cobalamin biosynthesis protein CobD (cobD) is a key enzyme involved in the aerobic biosynthesis pathway of vitamin B12 (cobalamin). CobD facilitates the attachment of aminopropanol to cobyrinic acid during the assembly of adenosylcobinamide, a critical intermediate in cobalamin production . This protein is essential for microbial cobalamin synthesis and has been studied for its structural and functional roles in P. stutzeri, a Gram-negative bacterium with metabolic versatility and bioremediation potential .

Role in Cobalamin Biosynthesis

In the aerobic cobalamin pathway, CobD operates downstream of cobalt chelation and adenosylation steps :

  1. Cobyrinic acid modification: After cobalt insertion by CobNST and adenosylation by CobO, CobD collaborates with CobC to attach (R)-1-amino-2-propanol (derived from threonine) to cobyrinic acid .

  2. Aminopropanol addition: This step converts adenosylcobyric acid to adenosylcobinamide, enabling subsequent phosphorylation and nucleotide loop assembly .

  3. Functional coordination: CobD works in tandem with CobS (cobalamin synthase) and CobT (alpha-ribazole synthase) to finalize coenzyme B12 .

Research Applications and Implications

  1. Bioremediation: P. stutzeri strains engineered for enhanced cobalamin synthesis could support mercury detoxification pathways, leveraging their native resistance to heavy metals .

  2. Membrane protein studies: P. stutzeri is a robust host for heterologous protein production, with success rates comparable to E. coli . CobD’s soluble nature makes it amenable to overexpression in such systems.

  3. Proteomics: Advanced workflows combining bottom-up and direct-sequencing proteomics have identified small proteins in P. stutzeri, though CobD itself was not highlighted in these studies .

Challenges and Future Directions

  • Functional characterization: The exact catalytic residues and kinetics of P. stutzeri CobD remain unvalidated experimentally.

  • Industrial scalability: Optimizing recombinant production in alternative hosts (e.g., P. stutzeri itself) could improve yields for biochemical studies .

  • Biotechnological applications: Engineering CobD variants could enhance cobalamin production in industrial microbial strains .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust this based on their needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobD; PST_1295; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
cobD
Target Protein Sequence
MSVFLSVIGALLLDALLGEPKRAHPLVAFGRLADRLEQHFNGAAGRGWRSHGVTAWCLAV LPLTLLAWLLSLLPGIGWLAEIVLLYLALGLRSLGEHALPVAQALWRHDLPEARRRVACI VSRDTSQLDEEGVARAATESVLENGSDAVFAALFWFIVAGAPGVVLYRLSNTLDAMWGYR NARFERFGWAAARIDDLLNYVPARLVAVTYALLGRTRRALRCWRTQAPLWDSPNAGPVMA AGAGALGVVLGGAAIYHGELHARPELGRGSAPQARHIEHALDLVWAGVGVWLLVLLFGGW LYA
Uniprot No.

Target Background

Function
This protein catalyzes the addition of aminopropanol to the F carboxylic group of cobyric acid, converting it to cobinamide.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas stutzeri and why is it significant for cobalamin biosynthesis research?

Pseudomonas stutzeri is a nonfluorescent denitrifying bacterium widely distributed in environmental niches and occasionally isolated as an opportunistic pathogen from humans. This species has received significant attention due to its diverse metabolic properties, including denitrification capacity, natural transformation abilities, dinitrogen fixation, and interactions with pollutants and toxic metals . While commercial production of vitamin B12 primarily utilizes Propionobacterium shermanii and Pseudomonas denitrificans , P. stutzeri represents an important model organism for studying metabolic diversity in cobalamin biosynthesis pathways due to its genetic accessibility and environmental adaptability.

When investigating P. stutzeri for cobalamin biosynthesis, researchers should consider its taxonomic diversity (with multiple genomovars identified) and optimize cultivation conditions specific to the strain being studied. Unlike some model organisms, P. stutzeri demonstrates considerable genetic variation that may influence cobalamin production pathways, requiring careful strain selection and characterization before proceeding with recombinant studies .

What is the specific function of CobD protein in the cobalamin biosynthetic pathway?

CobD functions as an L-threonine-O-3-phosphate decarboxylase in the cobalamin biosynthetic pathway, catalyzing the decarboxylation of L-threonine-O-3-phosphate to produce (R)-1-amino-2-propanol O-2-phosphate, an essential precursor for the aminopropanol linker that connects the nucleotide loop to the corrin ring in the final cobalamin structure. This enzymatic reaction represents one of approximately 30 enzymatic steps required for the complete biosynthesis of cobalamin .

The timing and integration of CobD activity differs between aerobic and anaerobic pathways. In the aerobic pathway characteristic of Pseudomonas species, CobD functions after the formation of the corrin ring structure but before the attachment of the nucleotide loop. This temporal organization differs from the anaerobic pathway found in organisms like Salmonella enterica, where the sequence of enzymatic reactions follows a distinct order .

How does the CobD protein from P. stutzeri compare structurally and functionally to homologs in other bacterial species?

While the search results don't provide direct comparative data for P. stutzeri CobD specifically, we can infer from the cobalamin biosynthesis pathways that significant homology likely exists between the CobD proteins of P. stutzeri and those of other aerobic cobalamin producers like P. denitrificans. The aerobic pathway in Pseudomonas species shows distinct characteristics compared to the anaerobic pathway in organisms like Salmonella enterica, particularly regarding the timing of cobalt insertion and the mechanism of ring contraction .

Comparative analysis shows that despite the presence of two distinct pathways (aerobic and anaerobic), many enzymes involved show high degrees of sequence similarity. This conservation facilitated the initial deciphering of the pathway in Salmonella, as functions could be predicted based on known enzymes from the aerobic pathway in P. denitrificans . When working with P. stutzeri CobD, researchers should consider these pathway similarities and differences when designing experiments or interpreting functional data.

What are the optimal expression systems for producing recombinant P. stutzeri CobD protein?

For recombinant expression of P. stutzeri CobD, E. coli-based expression systems typically offer the most accessible approach for laboratory-scale protein production. When designing expression constructs, researchers should consider the following methodological aspects:

  • Codon optimization: P. stutzeri has different codon usage patterns compared to E. coli, which may necessitate codon optimization of the cobD gene for efficient expression.

  • Affinity tags: N-terminal or C-terminal histidine tags facilitate purification while minimizing interference with protein folding and activity.

  • Expression conditions: Optimizing temperature, inducer concentration, and expression duration is critical, as lower temperatures (16-25°C) often improve solubility of recombinant proteins.

  • Solubility considerations: Addition of solubility-enhancing fusion partners (SUMO, MBP, or TrxA) may increase soluble protein yield if initial expression attempts produce primarily inclusion bodies.

The specific expression system should be selected based on the intended experimental application. For structural studies requiring high purity, affinity chromatography followed by size exclusion chromatography is recommended, while functional assays may proceed with partially purified protein preparations .

How can researchers design experiments to resolve contradictory findings regarding CobD activity or function?

Contradictory research results regarding CobD function may emerge from variations in experimental design rather than actual biological differences. To address such contradictions, researchers should implement the following methodological approaches:

  • Standardized enzyme assays: Develop and adhere to standardized assay conditions for CobD activity, including buffer composition, pH, temperature, substrate concentration, and detection methods. This standardization enables direct comparison between studies.

  • Control group selection: As highlighted by Anthes, the selection of appropriate control groups can significantly affect the strength of correlations discovered or even determine whether effects are observed at all . For CobD studies, include both positive controls (known functional CobD homologs) and negative controls (catalytically inactive mutants).

  • Multi-parameter experimental design: Apply design of experiments (DOE) methodology to systematically evaluate how multiple factors (temperature, pH, metal cofactors, substrate concentration) interact to influence CobD activity, rather than varying single parameters individually.

  • Cross-validation across methods: Confirm findings using complementary approaches (spectrophotometric assays, HPLC, mass spectrometry) to verify that results are not artifacts of specific analytical techniques .

When contradictory results persist despite methodological standardization, researchers should consider biological explanations, such as strain-specific differences in P. stutzeri CobD structure or regulation that may reflect evolutionary adaptations to different environmental niches .

What methods are most effective for detecting and quantifying P. stutzeri in environmental or experimental samples?

To effectively study P. stutzeri and its cobD gene in environmental or experimental samples, researchers have developed several specialized detection methods:

For cobD-specific detection, combining these methods with molecular approaches targeting the cobD gene can provide comprehensive information about both the presence of P. stutzeri and its cobalamin biosynthesis capability in complex samples.

How does the aerobic cobalamin biosynthesis pathway in P. stutzeri differ from the anaerobic pathway in other bacteria?

The cobalamin biosynthesis pathway shows significant divergence between aerobic and anaerobic bacteria, with P. stutzeri following the aerobic route similar to that characterized in P. denitrificans. Key differences between the pathways include:

FeatureAerobic Pathway (Pseudomonas species)Anaerobic Pathway (e.g., Salmonella)
Cobalt insertion timingLate stageEarly stage
Ring contraction mechanismRequires molecular oxygenOxygen-independent
Key enzymesCobG, CobJ, CobM, CobF, CobK, CobLCbiK, CbiL, CbiH, CbiF, CbiG, CbiD
Precursor compoundsPrecorrin intermediates without cobaltCobalt-precorrin intermediates

Both pathways share similarities in the peripheral modifications (methylation, decarboxylation, and amidation) that occur in the same temporal and spatial orders. While many enzymes are pathway-specific, others show high sequence similarity between pathways .

In the context of CobD function, its role in producing the aminopropanol linker is conserved across both pathways, though the precise timing of its activity relative to other biosynthetic steps may differ. When studying P. stutzeri CobD, researchers should frame their investigations within the context of the aerobic pathway, recognizing that regulatory mechanisms and metabolic integration may differ from those of anaerobic cobalamin producers .

What regulatory mechanisms control expression of the cobD gene in P. stutzeri?

While the search results don't provide specific information about cobD regulation in P. stutzeri, we can infer likely regulatory mechanisms based on what is known about cobalamin biosynthesis regulation in related organisms:

The expression of cobalamin biosynthetic operons is typically complex and modulated at multiple levels. In Salmonella, transcriptional regulation involves a sensor response regulator protein that activates transcription in response to environmental signals . For P. stutzeri, which shares metabolic similarities with P. denitrificans, the cobD gene is likely integrated into a regulatory network that responds to:

  • Oxygen availability: Given the oxygen-dependent nature of the aerobic pathway, oxygen sensors likely influence expression of cobD and other cobalamin biosynthesis genes.

  • Cobalt availability: As an essential cofactor for cobalamin, cobalt concentrations likely modulate pathway expression through metal-responsive transcription factors.

  • Carbon source and metabolic state: Since cobalamin biosynthesis is energetically expensive, requiring approximately 30 enzymatic steps , expression is likely tightly coupled to carbon metabolism and energy availability.

  • End-product feedback: Cobalamin or pathway intermediates may function in feedback loops to prevent overproduction.

To experimentally determine cobD regulation in P. stutzeri, researchers should consider promoter-reporter fusion assays, transcriptome analysis under varying conditions, and targeted mutation of potential regulatory elements to elucidate the specific control mechanisms governing cobD expression.

How can researchers engineer P. stutzeri to optimize recombinant CobD production for structural and functional studies?

Engineering P. stutzeri for optimized CobD production requires a multifaceted approach addressing several key aspects:

  • Promoter engineering: Replace the native cobD promoter with stronger, inducible promoters that allow controlled overexpression. For laboratory applications, promoters responsive to non-toxic inducers like IPTG, arabinose, or tetracycline offer practical advantages.

  • Ribosome binding site (RBS) optimization: Modifying the RBS sequence and spacing can significantly impact translation efficiency, with computational tools now available to predict optimal RBS designs for specific genes and host backgrounds.

  • Codon optimization: Adjust the cobD coding sequence to match the preferred codon usage patterns of P. stutzeri while maintaining key regulatory elements that may influence mRNA stability and translation.

  • Metabolic engineering: To support high-level protein production, engineer central metabolism to increase precursor and energy availability through approaches such as:

    • Enhancing glucose uptake and utilization

    • Reducing flux through competing pathways

    • Improving redox balance to support protein folding

  • Chaperone co-expression: Introduce additional folding chaperones (GroEL/GroES, DnaK/DnaJ) to improve the proportion of correctly folded CobD protein, particularly when expressing at high levels.

When implementing these strategies, researchers should apply design of experiments (DOE) methodology to systematically evaluate how multiple genetic modifications interact rather than testing changes individually . This approach can reveal non-obvious interactions between factors that significantly impact recombinant protein production.

What analytical methods provide the most comprehensive characterization of recombinant CobD protein structure and function?

A comprehensive characterization of recombinant CobD protein requires multiple complementary analytical approaches:

  • Structural analysis:

    • X-ray crystallography: Provides atomic-level resolution of protein structure, requiring pure, homogeneous, crystallizable protein

    • Nuclear Magnetic Resonance (NMR): Offers solution-state structural information and dynamics, particularly valuable for flexible regions

    • Circular Dichroism (CD): Assesses secondary structure content (α-helices, β-sheets) and thermal stability

    • Small-Angle X-ray Scattering (SAXS): Provides low-resolution structural information in solution, particularly useful for examining conformational changes

  • Functional characterization:

    • Enzyme kinetics: Determination of KM, kcat, and substrate specificity using purified components

    • Isothermal Titration Calorimetry (ITC): Measures binding thermodynamics for substrate and cofactor interactions

    • Mass spectrometry-based assays: Directly quantifies substrate consumption and product formation

    • Coupled enzyme assays: Allows continuous monitoring of activity through spectrophotometric detection

  • Stability and interaction studies:

    • Differential Scanning Fluorimetry (DSF): Measures thermal stability and can identify stabilizing conditions or ligands

    • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state and homogeneity

    • Surface Plasmon Resonance (SPR): Characterizes protein-protein interactions with other cobalamin biosynthesis enzymes

The selection of analytical methods should be guided by the specific research questions being addressed. For initial characterization, a combination of CD spectroscopy (structure), activity assays (function), and DSF (stability) provides an efficient workflow before proceeding to more resource-intensive techniques like crystallography .

How can researchers distinguish between different genomovars of P. stutzeri when studying cobD function and expression?

The high genetic diversity of P. stutzeri, with multiple distinct genomovars, presents a challenge for researchers studying cobD function across strains. To distinguish between genomovars and accurately characterize strain-specific variations in cobD, researchers should implement:

  • Multilocus Sequence Typing (MLST): Analysis of multiple housekeeping genes provides reliable genomovar classification. For P. stutzeri, established MLST schemes can accurately place strains within the appropriate genomovar .

  • PCR-RFLP analysis: PCR amplification of the cobD gene followed by restriction fragment length polymorphism analysis can rapidly identify strain-specific variations without full sequencing.

  • Whole genome sequencing: For comprehensive characterization, whole genome sequencing provides complete information about not only cobD but also other genes that may influence cobalamin biosynthesis.

  • Specific DNA probes: As demonstrated by Bennasar et al., specific DNA probes can be developed to target genomovar-specific sequences, allowing rapid identification of strains .

  • FISH techniques: Fluorescence in situ hybridization with genomovar-specific probes enables direct visualization and quantification of different P. stutzeri genomovars in mixed cultures or environmental samples .

When comparing cobD function across genomovars, researchers should sequence the cobD gene from each strain to identify amino acid variations that might affect protein function, then perform comparative enzymatic analyses to determine whether these variations translate to functional differences in CobD activity or regulation.

What approaches can resolve contradictory data about CobD function in cobalamin biosynthesis?

When researchers encounter contradictory results regarding CobD function, a systematic troubleshooting approach is essential to determine whether differences reflect true biological variation or methodological discrepancies:

  • Meta-analysis of experimental designs: As highlighted by Anthes, seemingly contradictory results may stem from subtle differences in experimental design rather than actual biological differences . Researchers should conduct a detailed analysis of methodological variables across studies, including:

    • Strain backgrounds and genomovars

    • Expression systems and protein tags

    • Assay conditions (buffer composition, pH, temperature)

    • Substrate sources and purity

    • Detection methods and data analysis approaches

  • Standardized comparative analysis: Perform side-by-side testing of CobD proteins from different sources under identical conditions, including:

    • Expression from the same vector system

    • Identical purification protocols

    • Parallel activity assays with shared reagents

    • Multiple detection methods to verify consistency

  • Structural analysis of variants: When functional differences persist despite methodological standardization, structural studies (crystallography or modeling) can identify variations in active site architecture or substrate binding regions that might explain functional differences.

  • In vivo complementation: Test the ability of different cobD variants to complement cobD-deficient strains under standardized growth conditions, providing a physiologically relevant measure of functional equivalence.

Importantly, apparent contradictions may reflect genuine biological differences rather than errors. The high genetic diversity of P. stutzeri, with multiple genomovars showing distinct ecological adaptations , suggests that strain-specific variations in cobD function could represent evolutionary adaptations to different environmental niches rather than experimental artifacts.

How does CobD interact with other enzymes in the cobalamin biosynthetic pathway?

CobD functions within a complex network of approximately 30 enzymatic steps required for complete cobalamin biosynthesis . While the search results don't provide direct information about CobD's specific interactions, we can infer its integration based on pathway knowledge:

In the aerobic pathway characteristic of Pseudomonas species, CobD produces (R)-1-amino-2-propanol O-2-phosphate, which serves as a precursor for the aminopropanol linker connecting the nucleotide loop to the corrin ring structure. This places CobD in a critical position between corrin ring synthesis and nucleotide loop attachment.

Potential interaction partners for CobD likely include:

  • Enzymes involved in nucleotide loop assembly: CobD product feeds directly into this process, suggesting physical or substrate-channeling interactions may exist.

  • Regulatory proteins: Given the energetic cost of cobalamin biosynthesis, coordinated regulation of pathway enzymes is likely, potentially involving protein-protein interactions that modulate activity.

  • Metabolic enzymes providing precursors: L-threonine metabolism enzymes may interact with CobD to coordinate precursor availability.

To experimentally characterize these interactions, researchers should consider:

  • Pull-down assays with tagged CobD to identify binding partners

  • Bacterial two-hybrid screening to detect binary interactions

  • Co-immunoprecipitation followed by mass spectrometry to identify interaction networks

  • In vitro reconstitution of partial pathways to detect functional interactions

Understanding these interactions is critical for building accurate models of pathway flux and regulation, which in turn inform metabolic engineering approaches for enhanced cobalamin production .

What are the rate-limiting steps in cobalamin biosynthesis, and could CobD function be a bottleneck?

The cobalamin biosynthetic pathway involves approximately 30 enzymatic steps , creating multiple potential rate-limiting points. While the search results don't specifically identify CobD as a bottleneck, we can analyze its potential rate-limiting role based on pathway organization:

Rate-limiting steps in metabolic pathways typically share certain characteristics:

  • They are often irreversible reactions

  • They may occur at pathway branch points

  • They frequently involve complex regulatory mechanisms

  • Their products may be unstable or have limited availability

For CobD in particular, its position in producing a key linker component suggests potential rate-limiting characteristics:

To experimentally determine whether CobD represents a rate-limiting step, researchers should:

  • Conduct metabolic flux analysis with isotopically labeled precursors

  • Perform controlled overexpression studies to identify which enzymes increase pathway flux when overexpressed

  • Measure intermediate pool sizes to identify accumulation points suggesting downstream bottlenecks

  • Apply metabolic control analysis to quantify flux control coefficients for pathway enzymes

Understanding rate-limiting steps is particularly important when considering metabolic engineering for enhanced cobalamin production in recombinant systems .

What methodological approaches can resolve contradictions in experimental results when studying CobD in different bacterial species?

When researchers encounter contradictory results regarding CobD function across different bacterial species, several methodological approaches can help resolve these discrepancies:

  • Standardized heterologous expression: Express CobD proteins from different bacterial sources in a common host system (e.g., E. coli) using identical expression vectors, affinity tags, and purification protocols to minimize system-specific variables.

  • Controlled in vitro reconstitution: Establish defined in vitro assay systems with purified components to eliminate the influence of species-specific cellular environments on enzyme activity measurements.

  • Chimeric protein analysis: Create chimeric CobD proteins exchanging domains between species variants to identify regions responsible for functional differences.

  • Comparative structural analysis: Determine crystal structures of CobD proteins from multiple species to identify structural differences that might explain functional variations.

  • Systematic mutagenesis: Perform site-directed mutagenesis to convert species-specific amino acid residues to their counterparts in other species, directly testing their contribution to functional differences.

  • Document all experimental conditions comprehensively

  • Compare methods across studies before concluding biological differences exist

  • Consider that apparent contradictions may reflect genuine evolutionary adaptations to different ecological niches

  • Apply multiple complementary techniques to verify findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.