Recombinant Pseudomonas stutzeri Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant YidC is primarily expressed in E. coli , but P. stutzeri itself serves as an alternative host for membrane protein production due to:

  • High-Yield Expression: Compatible with arabinose-inducible vectors (e.g., pL2020) .

  • Cost-Effective Culturing: Grows in standard media (e.g., LB or marine broth) at 28–37°C .

  • Folding Efficiency: Superior for certain membrane proteins compared to E. coli .

For purification, immobilized metal affinity chromatography (IMAC) is used, yielding >90% pure protein .

Functional Role

YidC operates via two pathways:

  1. Sec-Independent Insertion: Directly integrates single-spanning proteins (e.g., Pf3 coat) into membranes without Sec translocon involvement .

  2. Sec-YidC Collaboration: Assists Sec machinery in inserting multi-spanning proteins (e.g., MelB permease) .

Key mechanisms include:

  • Hydrophobic Groove Interaction: Bands substrate transmembrane domains via residues like R72 .

  • Conformational Flexibility: Undergoes structural changes to accommodate substrate insertion .

Substrate Binding Dynamics

  • Kinetics: Binds substrates within 2 ms, stabilizing them within 52 ms .

  • Force Spectroscopy: YidC reduces conformational variability of substrates (e.g., Pf3 coat) during insertion .

Chaperone Activity

YidC prevents misfolding in polytopic proteins like MelB permease by accelerating stepwise insertion of α-helical domains .

Evolutionary Conservation

YidC homologs exist across all domains of life, with bacterial versions sharing a conserved five-transmembrane core critical for function .

Applications

  • Membrane Protein Studies: Reconstituted into proteoliposomes to analyze insertion mechanisms .

  • Biotechnology: Used to overexpress challenging membrane proteins (e.g., transporters) in P. stutzeri .

  • Drug Discovery: Target for antibiotics disrupting membrane protein biogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order for our fulfillment.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; PST_4211; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
yidC
Target Protein Sequence
MDIKRSILLVALAVVAYLMVLQWNQDYGQAALPTETAQSQPAAPALPDSPSATTEGNAND VPAVAGQQQASALPTSAPSSQLIRVRTDVLDLAIDPRGGDIVELHLPQYPRRQDRPDVPF QLFERSSERTYEAQSGLIGDGPDKASGRPQYSSEKTEYQLAEGQDALVVDLNYSADGVNY IKRFTLERGNYALKVNYLIDNQSQQPWTGYLFGQLKRDKSGDPSSSTATGTATYLGAALW TKDEPYRKVSMSNMDDKNLRETVQGGWIAWLQHYFVTAWIPQAGDTNQVQTRKDSQGNYI IGFTGPAVTVPAGAQGETGATLYAGPKSQDKLEELSPGLRLTVDYGILWFIAQPIFWLLQ NIHALLGNWGWSIIVLTIVIKLAFFPLSAASYRSMARMRAVSPKMQALKEQFGDDRQKMS QAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWMFWITDLSIKDPYF ILPIIMGVTMFIQQQLNPTPPDPMQARVMKLLPIIFTFFFLWFPAGLVLYWVVNNILSIA QQWYITRQIEAGAKPA
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Additionally, it aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas stutzeri and why is it valuable for membrane protein research?

Pseudomonas stutzeri is a species complex with extremely broad phenotypic and genotypic diversity, comprising at least six well-defined species and 27 genomovars (genomically distinct groups). This bacterium has been isolated from diverse ecological niches, including soil, saline environments, and clinical settings . P. stutzeri has gained attention as an alternative production host for membrane proteins with success rates comparable to the traditional Escherichia coli system .

The value of P. stutzeri in membrane protein research lies in its complementary nature to E. coli—some membrane proteins that express poorly in E. coli may express at high yields in P. stutzeri and vice versa. When both systems are used in parallel, researchers can significantly increase their chances of successfully producing difficult-to-express membrane proteins .

What is YidC insertase and what role does it play in membrane protein biogenesis?

YidC is a highly conserved bacterial membrane protein insertase that facilitates the insertion and folding of proteins into cellular membranes. It represents one of the two main insertion systems in bacteria, alongside the Sec translocase system (SecYEG proteins) . The significance of YidC extends beyond bacteria, as it shares homology with Alb3 in chloroplasts and Oxa1 in mitochondria, indicating its evolutionary importance across multiple domains of life .

Mechanistically, YidC helps overcome the thermodynamic barrier that prevents hydrophilic polypeptide residues from passing through the hydrophobic core of the membrane. While hydrophobic transmembrane segments can insert spontaneously into membranes, the assistive function of YidC is crucial for proper insertion and folding, preventing toxic aggregation of membrane proteins .

How does P. stutzeri compare to E. coli as a host for recombinant membrane protein production?

P. stutzeri offers comparable success rates to E. coli for membrane protein production, but with important differences that make it a valuable complementary expression system:

What is the mechanism of YidC-mediated membrane protein insertion at the molecular level?

YidC employs a sophisticated multi-step process to insert membrane proteins. Single-molecule force spectroscopy, fluorescence spectroscopy, and molecular dynamics simulations have revealed the following sequence:

  • Initial binding (within 2 ms): The cytoplasmic α-helical hairpin of YidC binds the substrate polypeptide (e.g., membrane protein Pf3) with high conformational variability and kinetic stability .

  • Conformational strengthening (within 52 ms): YidC strengthens its interaction with the substrate and utilizes both its cytoplasmic α-helical hairpin domain and hydrophilic groove to facilitate transfer to the membrane .

  • Insertion and folding: The substrate transitions to a membrane-inserted, folded state where it adopts the low conformational variability characteristic of transmembrane α-helical proteins .

This mechanism demonstrates how YidC overcomes the energetic barriers to membrane insertion by providing a protected environment for the substrate during the transition from an aqueous to a lipidic phase.

How can researchers optimize the use of P. stutzeri for challenging membrane protein expression?

For membrane proteins that express poorly in conventional systems, P. stutzeri offers several optimization strategies:

  • Vector selection: The pL2020 vector was specifically designed for membrane protein expression in P. stutzeri. Unlike previous systems that used the endogenous cbb3 oxidase promoter (which lacks tight control), optimized vectors allow better regulation of expression levels .

  • Protein source consideration: P. stutzeri is particularly valuable as a "quasi homologous" production system for proteins from other Pseudomonas species. For example, membrane transporters from the human pathogen P. aeruginosa show improved expression in P. stutzeri due to their close systematic relationship .

  • Protein family evaluation: Researchers have successfully expressed membrane proteins from at least 14 different protein families in P. stutzeri, with transporters being particularly amenable to this expression system .

  • Parallel screening: The most effective approach is testing expression in both E. coli and P. stutzeri simultaneously, as individual membrane proteins may perform unexpectedly better in one system versus the other .

What genomic and physiological attributes of P. stutzeri contribute to its effectiveness as an expression host?

Several genomic and physiological characteristics make P. stutzeri suitable for recombinant protein expression:

  • Genomic adaptability: P. stutzeri demonstrates an open pan-genome comprising 13,261 gene families with extensive genetic gain and loss events driving diversification. This genomic plasticity may contribute to its ability to handle foreign genes .

  • Stress tolerance mechanisms: The universal presence of the ectoine biosynthesis gene cluster (ectABCD-ask) in P. stutzeri complex genomes suggests an evolutionary origin in high-osmolarity environments. These osmoprotective mechanisms may help stabilize overexpressed membrane proteins .

  • Moderate genome size and GC content: P. stutzeri complex genomes range from 3.674 to 5.319 Mb (average 4.566 Mb) with GC contents between 59.6% and 65.18% (average 63.12%). This provides sufficient metabolic capacity while maintaining reasonable genetic stability for heterologous expression .

What expression systems and vectors are available for recombinant protein production in P. stutzeri?

For effective recombinant protein expression in P. stutzeri, researchers have developed specialized expression systems:

The advantage of the newer pL2020 vector is that it enables parallel testing in both E. coli and P. stutzeri without requiring additional cloning steps, streamlining the experimental process when evaluating multiple expression hosts .

What techniques are most effective for studying YidC-mediated membrane protein insertion?

Research on YidC-mediated membrane protein insertion has benefited from multiple complementary approaches:

  • Single-molecule force spectroscopy: This technique allows researchers to examine the physical forces involved in membrane protein insertion and the interaction between YidC and its substrates at the individual molecule level .

  • Fluorescence spectroscopy: This approach enables real-time monitoring of conformational changes and interactions during the insertion process, providing insights into the dynamics of YidC function .

  • Molecular dynamics simulations: Computational modeling complements experimental approaches by predicting structural transitions and energetics of the insertion process at atomic resolution .

  • Combined approaches: The most powerful insights come from integrating multiple techniques. For example, researchers have determined that within 2 ms, the cytoplasmic α-helical hairpin of YidC binds polypeptide substrates, and within 52 ms, YidC strengthens this binding and transfers the substrate to its membrane-inserted state .

How can researchers address the diversity within the P. stutzeri complex when selecting strains for recombinant expression?

The P. stutzeri complex exhibits remarkable diversity, comprising at least six defined species and 27 genomovars. When selecting strains for recombinant protein expression, researchers should consider:

  • Genomovar classification: Through average nucleotide identity (ANI) evaluation and phylogenetic analysis, researchers have identified 27 genomovars within the P. stutzeri complex, including 16 known and 11 unknown genomovars. Strains from different genomovars may have different expression characteristics .

  • Strain verification: Approximately 10% of P. stutzeri complex strains in databases have mistaken taxonomic assignments. Researchers should verify strain identity through ANI analysis (≥~95%) and digital DNA-DNA hybridization (dDDH) values (≥~60%) combined with phylogenomic analysis .

  • Source environment consideration: P. stutzeri strains have been isolated from soil, saline environments, and clinical settings. The original habitat may influence a strain's physiological properties and potentially its performance as an expression host .

  • Genome size and gene content: P. stutzeri complex strains have genome sizes ranging from 3.674 to 5.319 Mb with an average of 4,129 coding sequences. The specific gene content of individual strains may affect their metabolic capabilities and expression profiles .

What are common challenges when working with recombinant P. stutzeri and YidC, and how can they be addressed?

When working with P. stutzeri for recombinant protein expression, especially for YidC and other membrane proteins, several challenges may arise:

  • Expression level variability: Unlike E. coli, which has been extensively optimized for recombinant expression, P. stutzeri systems may show greater variability between experiments.

    Solution: Standardize growth conditions rigorously and consider testing multiple strains from the P. stutzeri complex to identify the optimal host for your specific protein.

  • Vector stability: Broad-host-range vectors may show different stability characteristics in P. stutzeri compared to E. coli.

    Solution: The pL2020 vector was specifically designed for P. stutzeri expression. Maintaining appropriate antibiotic selection and optimizing copy number can improve stability .

  • Membrane protein toxicity: Overexpression of membrane proteins can be toxic to the host cell.

    Solution: Fine-tune expression levels by adjusting inducer concentration and induction timing. The tight control offered by newer vectors like pL2020 is advantageous over earlier systems that used the less controllable endogenous cbb3 oxidase promoter .

How can researchers apply knowledge of YidC's mechanism to improve membrane protein expression?

Understanding YidC's natural function provides insights for optimizing membrane protein expression:

  • Co-expression strategies: Since YidC facilitates membrane protein insertion, co-expressing YidC along with the target membrane protein may improve insertion efficiency and folding.

    Approach: Design constructs that co-express YidC at moderate levels alongside the target protein, potentially creating a more supportive environment for membrane insertion.

  • Targeting sequence optimization: YidC recognizes specific features in substrate proteins during the initial binding phase via its cytoplasmic α-helical hairpin domain .

    Approach: Modify the N-terminal region of difficult-to-express proteins to better match the recognition patterns of YidC, potentially improving insertion efficiency.

  • Expression timing: YidC-mediated insertion occurs in distinct temporal phases (initial binding within 2 ms, conformational strengthening within 52 ms) .

    Approach: Adjust expression rates to allow sufficient time for these processes, potentially by using lower temperatures or weaker promoters that slow protein synthesis.

What are promising areas for further research on P. stutzeri and YidC in membrane protein studies?

Several exciting research directions could advance our understanding of both P. stutzeri as an expression host and YidC function:

  • Strain engineering: The genomic diversity within the P. stutzeri complex (27 genomovars) offers opportunities to develop specialized expression strains optimized for different classes of membrane proteins .

    Research approach: Comparative analysis of expression performance across multiple genomovars to identify genetic factors that enhance membrane protein production.

  • Structural studies of P. stutzeri YidC: While YidC function has been characterized in other bacteria, detailed structural information about P. stutzeri YidC could reveal species-specific features.

    Research approach: Cryo-electron microscopy or X-ray crystallography of P. stutzeri YidC, particularly in complex with substrate proteins during various stages of insertion.

  • Integration with other membrane protein insertion systems: In bacteria, YidC works alongside the Sec translocase system and can function both independently and in cooperation with SecYEG .

    Research approach: Investigation of how these systems interact in P. stutzeri and how this could be leveraged for improved heterologous expression of complex membrane proteins.

  • Application to biotechnologically relevant membrane proteins: P. stutzeri is known for specific physiological properties including denitrification, nitrogen fixation, and degradation of aromatic compounds .

    Research approach: Expression of membrane proteins involved in bioremediation or industrial processes, leveraging P. stutzeri's native capabilities in these areas.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.