Recombinant Pseudomonas stutzeri Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Research Applications and Functional Insights

Role in the NQR Complex
Subunit E is part of a multi-subunit NQR complex that generates a sodium motive force during respiration. While the exact function of subunit E remains under investigation, structural homology suggests it contributes to:

  • Cofactor Binding: Stabilization of quinone or flavin intermediates.

  • Ion Channel Formation: Participation in Na⁺ translocation pathways .

Experimental Relevance
Recombinant subunit E is used to study:

  1. Structural Dynamics: Mutagenesis of conserved residues (e.g., cysteine motifs) to map functional domains.

  2. Inter-Subunit Interactions: Co-expression with other NQR subunits to analyze complex assembly.

  3. Electron Transfer Pathways: Kinetic assays to quantify redox activity under varying Na⁺ concentrations .

Production and Handling

Commercial Availability
Recombinant subunit E is marketed for research use, with typical specifications:

ParameterDetails
Quantity50 µg (custom quantities available)
PurityHigh (optimized for biochemical assays)
FormLyophilized powder

Handling Recommendations

  • Storage: Maintain at -20°C or -80°C for long-term stability.

  • Working Aliquots: Store at 4°C for ≤1 week to prevent degradation .

Comparative Context in NQR Complexes

While subunit E from Pseudomonas stutzeri is distinct from homologs in alkaliphilic bacteria (e.g., Thioalkalivibrio), all share conserved motifs linked to Na⁺ translocation. For example, residues near transmembrane helices may form ion-binding pockets, as inferred from structural models of Na⁺-pumping cytochrome cbb₃ oxidase .

Research Gaps and Future Directions

Current limitations include:

  • Structural Data: No crystallographic or cryo-EM structures of subunit E alone.

  • Functional Specificity: Mechanistic studies on its role in Na⁺ pumping vs. electron transfer.

Future work may leverage recombinant subunit E to dissect:

  • Cofactor Interactions: Binding kinetics of FMN or quinones.

  • Ion Pathways: Site-directed mutagenesis to identify Na⁺-binding residues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; PST_2651; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVRAVFIENMALAFFLGMCTFIAISKKVETAIGLGIAVIVVQTITVPANNLIY TYLLKSGALAWAGLPEVDLSFLGLLSYIGVIAAIVQILEMTLDKYVPSLYNALGVFLPLI TVNCAIMGGTLFMVERDYNLGESVVYGMGSGLSWALAIALLAGIREKLKYSDVPDGLQGL GITFITIGLMSLGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase subunit E and what is its function?

Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is one of the components of the Na(+)-NQR complex in Pseudomonas stutzeri, playing a critical role in the respiratory chain. This membrane-bound protein complex (NQR) catalyzes the oxidation of NADH coupled to Na+ translocation across the membrane. The NqrE subunit, specifically, contributes to the formation of the membrane-spanning domain that enables Na+ transport. The protein consists of 202 amino acids and functions within the transmembrane region of the NQR complex, facilitating ion transport coupled to electron transfer .

How should recombinant Pseudomonas stutzeri NqrE be stored for optimal stability?

For optimal stability of recombinant P. stutzeri NqrE, the protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for regular use, or at -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles, which can significantly compromise protein integrity. It's critical to avoid repeated freezing and thawing of the protein solution as this can lead to denaturation and aggregation . When preparing working stocks, small aliquots should be created to prevent the need for multiple freeze-thaw cycles of the master stock.

What are the recommended protocols for purifying recombinant Pseudomonas stutzeri NqrE?

Purification of recombinant P. stutzeri NqrE requires specialized approaches due to its hydrophobic nature as a membrane protein. A recommended protocol involves:

  • Expression in a bacterial system using a vector with an appropriate tag (often His-tag)

  • Cell lysis using gentle detergents (e.g., n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane proteins

  • Initial purification using immobilized metal affinity chromatography (IMAC)

  • Secondary purification via ion exchange or size exclusion chromatography

  • Verification of purity using SDS-PAGE and Western blotting

The presence of detergents throughout the purification process is critical to maintain protein solubility and native conformation. When purifying NqrE as part of the complete NQR complex, gentler solubilization conditions may be necessary to preserve protein-protein interactions .

How can researchers effectively reconstitute Na(+)-NQR activity in vitro using recombinant subunits?

Reconstitution of Na(+)-NQR activity using recombinant subunits requires careful assembly of all components (NqrA through NqrF). A methodological approach includes:

  • Co-expression of all subunits or purification and reconstitution from individually expressed components

  • Incorporation of essential cofactors including FMN, FAD, and FeS clusters

  • Preparation of proteoliposomes using phospholipids that mimic the native membrane environment

  • Verification of proper assembly using cross-linking studies and electron microscopy

  • Activity measurements through monitoring of:

    • NADH oxidation (spectrophotometric measurement at 340 nm)

    • Quinone reduction (spectrophotometric changes)

    • Na+ translocation (using fluorescent probes like SBFI or radioactive 22Na+)

Successful reconstitution typically requires optimization of lipid composition, protein-to-lipid ratios, and buffer conditions to achieve maximal activity comparable to the native complex .

What experimental approaches can be used to study electron transfer mechanisms in the NQR complex?

Several experimental approaches can be employed to study electron transfer in the NQR complex:

When applying these techniques to NqrE specifically, researchers should focus on its interactions with other NQR subunits rather than direct electron transfer, as NqrE primarily serves a structural role in the complex while electron transfer occurs through other subunits containing flavin and iron-sulfur centers .

How does the mechanism of Na(+)-translocating NQR differ from H(+)-translocating NADH:quinone oxidoreductases?

The Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) fundamentally differs from H+-translocating NADH:quinone oxidoreductases (Complex I) in several aspects:

  • Subunit composition: Na+-NQR consists of six subunits (NqrA-F) whereas Complex I contains 14-46 subunits depending on the organism

  • Cofactor content: Na+-NQR contains FMN, FAD, and potentially iron but lacks the extensive iron-sulfur clusters found in Complex I

  • Evolutionary origin: Na+-NQR is not homologous to Complex I, representing a distinctly evolved enzyme complex

  • Ion specificity: Na+-NQR selectively transports Na+ ions, while Complex I transports H+

  • Electron transfer pathway: In Na+-NQR, electron transfer proceeds from NADH through FAD in NqrF, then to FMN in NqrC and possibly NqrB, finally to quinone. This pathway differs substantially from the linear electron transfer chain in Complex I

The NqrE subunit specifically contributes to forming the Na+ translocation pathway, creating a channel-like structure that facilitates sodium ion movement across the membrane during catalysis . The distinct architecture of Na+-NQR enables the complex to couple electron transfer to Na+ transport rather than proton translocation, providing a specialized energy conservation mechanism in certain bacterial species.

What is the significance of flavinylation in electron transfer proteins and how does it affect NQR function?

Flavinylation is a post-translational modification involving the covalent attachment of flavin cofactors (FMN or FAD) to specific amino acid residues in proteins. This modification is particularly significant in electron transfer proteins for several reasons:

  • Enhanced redox stability: Covalently attached flavins have modified redox potentials compared to free flavins

  • Prevention of cofactor loss: Covalent attachment ensures flavin retention during catalytic cycles

  • Altered electron transfer kinetics: The covalent linkage can modify the rate and specificity of electron transfer

  • Structural stabilization: Flavinylation can contribute to proper protein folding and complex assembly

In the Na+-NQR complex, flavinylation occurs in the NqrB and NqrC subunits, where FMN is covalently attached to threonine residues. This modification is catalyzed by a specific flavin transferase enzyme. While NqrE itself is not directly flavinylated, the flavinylation of other NQR subunits is essential for the electron transfer pathway that ultimately drives Na+ translocation through the membrane domain containing NqrE .

Interestingly, similar flavinylation mechanisms have been observed in other electron transfer systems. For example, the NosR protein in Pseudomonas stutzeri contains a flavin-binding domain similar to that found in NqrC, where FMN is covalently bound as a phosphodiester to a threonine residue . This conserved flavinylation mechanism suggests an important evolutionary adaptation for efficient electron transfer in diverse bacterial respiratory systems.

How do mutations in the nqrE gene affect bacterial bioenergetics and potential pathogenicity?

Mutations in the nqrE gene can have profound effects on bacterial bioenergetics and potentially influence pathogenicity through several mechanisms:

  • Energy metabolism disruption: NqrE mutations can compromise Na+ gradient formation, reducing the energy available for cellular processes

  • Respiratory flexibility impairment: Bacteria with dysfunctional NqrE may show reduced ability to adapt to changing environmental conditions

  • Membrane potential alterations: Disruption of Na+ translocation can affect membrane potential, influencing numerous cellular functions

  • Stress response modifications: Changes in ion gradients can trigger stress responses, altering gene expression patterns

  • Virulence factor regulation: In pathogenic bacteria, Na+ gradients may be linked to virulence factor expression

Research has indicated that the Na+-NQR complex may contribute to pathogenicity in certain bacterial species by supporting growth in ion-limited environments often encountered during infection. Additionally, the Na+ gradient generated by Na+-NQR can drive secondary transporters involved in nutrient acquisition and toxin export . A systematic analysis of nqrE mutations could provide valuable insights into bacterial adaptation mechanisms and potentially identify new targets for antimicrobial development.

How is the Na(+)-translocating NQR complex from Pseudomonas stutzeri evolutionarily related to similar complexes in other bacteria?

The Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) complex found in Pseudomonas stutzeri represents a specialized respiratory enzyme with distinct evolutionary origins compared to the more common H+-translocating Complex I. Phylogenetic analysis reveals several key evolutionary relationships:

  • Na+-NQR is distributed across diverse bacterial phyla, including Proteobacteria, Firmicutes, and Bacteroidetes, suggesting either ancient origins or horizontal gene transfer

  • The NqrE subunit specifically shows conservation in membrane-spanning regions across species, reflecting functional constraints on the ion channel structure

  • Comparative genomics indicates that the complete nqr operon structure is largely conserved in organisms possessing this complex

  • Sequence analysis suggests that Na+-NQR evolved independently from Complex I, representing convergent evolution for NADH oxidation coupled to ion translocation

Interestingly, the flavin-binding domain architecture found in some NQR subunits shows similarities to other respiratory proteins, including NosR from denitrifying bacteria. For instance, the flavin-binding domain of NosR is found in the NqrC subunit of the Na+-translocating NADH:quinone oxidoreductase in Vibrio species, where FMN is covalently bound as a phosphodiester to a threonine residue . This suggests potential domain sharing or common ancestry between different respiratory complexes across bacterial lineages.

What are the key differences between Na(+)-NQR complexes from Pseudomonas stutzeri and Vibrio species?

Despite serving similar bioenergetic functions, the Na(+)-NQR complexes from Pseudomonas stutzeri and Vibrio species exhibit notable differences:

FeaturePseudomonas stutzeri Na+-NQRVibrio species Na+-NQR
Subunit compositionSix subunits (NqrA-F)Six subunits (NqrA-F) with sequence variations
Redox cofactorsFAD, FMN, Fe-S centersFAD, FMN, ubiquinone-8, riboflavin
Na+ translocation efficiencyLower pumping ratioHigher pumping ratio (1.5 Na+/e-)
Quinone specificityPrefers ubiquinoneFunctions with ubiquinone and menaquinone
Salt toleranceModerate halotoleranceHigh halotolerance
Structural stabilityModerate thermostabilityHigher thermostability

How has the function of Na(+)-translocating NQR complexes been adapted in different ecological niches?

The Na(+)-translocating NADH:quinone oxidoreductase complex has undergone functional adaptations across diverse ecological niches, demonstrating its versatility as a bioenergetic mechanism:

  • Marine environments: In marine Vibrio species, Na+-NQR is optimized for high salt concentrations, enabling energy conservation in Na+-rich environments

  • Alkaline habitats: Organisms from alkaline environments utilize Na+-NQR as H+ becomes limiting for bioenergetics at high pH

  • Host-associated niches: In pathogenic bacteria, Na+-NQR may contribute to survival in host environments where ion gradients differ from external environments

  • Anaerobic settings: Some anaerobes utilize Na+-NQR variants adapted to function with alternative electron acceptors

  • Extreme environments: Thermophilic and halophilic bacteria show specialized Na+-NQR adaptations for stability under extreme conditions

The NqrE subunit's sequence and structural features often reflect these ecological adaptations. For example, in halophilic bacteria, the NqrE subunit typically contains a higher proportion of acidic residues on the protein surface, promoting stability in high-salt environments. In thermophilic species, additional stabilizing interactions within NqrE help maintain structural integrity at elevated temperatures .

What are common challenges in expressing and purifying recombinant Pseudomonas stutzeri NqrE and how can they be addressed?

Expressing and purifying recombinant Pseudomonas stutzeri NqrE presents several challenges due to its nature as a membrane protein:

ChallengeManifestationSolution
Poor expressionLow protein yieldOptimize codon usage; use specialized expression strains (C41/C43); employ inducible promoters with tightly controlled expression
Inclusion body formationProtein aggregationLower induction temperature (16-20°C); reduce inducer concentration; add solubilizing agents during expression
Protein misfoldingLoss of functional structureCo-express with chaperones; use membrane-mimetic expression systems
Difficult extractionPoor solubilizationTest different detergents (DDM, LDAO, CHAPS); optimize detergent-to-protein ratio
Protein instabilityDegradation during purificationAdd protease inhibitors; maintain low temperature; include stabilizing agents (glycerol, specific lipids)
Low purityContaminant proteinsImplement multiple chromatography steps; consider on-column refolding approaches

When working specifically with NqrE, it's important to maintain the protein in a membrane-like environment throughout purification. The use of mixed micelles or nanodiscs can help preserve the native conformation. Additionally, when storing purified NqrE, a Tris-based buffer with 50% glycerol is recommended for optimal stability .

How can researchers overcome difficulties in measuring Na(+) translocation activity of the NQR complex?

Measuring Na+ translocation activity of the NQR complex presents technical challenges that can be addressed through several methodological approaches:

  • Establishment of a reliable Na+ gradient detection system:

    • Use Na+-sensitive fluorescent dyes (SBFI, CoroNa Green)

    • Employ 22Na+ radioisotope-based transport assays

    • Implement Na+-selective electrodes for direct measurement

  • Creation of sealed membrane vesicles:

    • Ensure proper orientation (right-side-out or inside-out)

    • Verify vesicle integrity using impermeant markers

    • Control for non-specific Na+ leakage

  • Distinction between Na+ translocation and other ion movements:

    • Use specific inhibitors (CCCP for H+ gradients)

    • Perform control experiments with Na+-free buffers

    • Apply mathematical models to distinguish coupled ion movements

  • Correlation of Na+ movement with electron transfer:

    • Simultaneously monitor NADH oxidation and Na+ translocation

    • Establish stoichiometry through calibrated measurements

    • Verify coupling by manipulating membrane potential

When troubleshooting Na+ translocation assays, researchers should systematically test buffer compositions, particularly considering the impact of other ions that might compete with Na+ transport or affect membrane properties. Additionally, reconstituting the NQR complex into liposomes with defined lipid composition can provide a controlled environment for reliable measurements .

What analytical techniques can help resolve contradictory data on NQR electron transfer pathways?

When facing contradictory data regarding NQR electron transfer pathways, researchers can employ multiple complementary analytical techniques to resolve discrepancies:

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption spectroscopy to capture short-lived intermediates

    • Temperature-dependent kinetic studies to identify rate-limiting steps

    • Spectral deconvolution to identify overlapping signals from different cofactors

  • Site-specific probing:

    • Site-directed spin labeling coupled with EPR spectroscopy

    • Introduction of fluorescent probes at specific residues

    • Isotope labeling of specific cofactors for NMR studies

  • Structural methods:

    • Cryo-electron microscopy to visualize the intact complex

    • X-ray crystallography of individual subunits or subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

  • Computational approaches:

    • Quantum mechanical/molecular mechanical (QM/MM) simulations

    • Molecular dynamics to model conformational flexibility

    • Electron transfer pathway prediction algorithms

  • Genetic approaches:

    • Construction of chimeric proteins to identify functional domains

    • Suppressor mutation analysis to identify interacting components

    • In vivo complementation studies with heterologous components

By integrating data from multiple techniques and considering the experimental conditions that led to contradictory results (such as detergent effects, protein modifications, or measurement artifacts), researchers can develop a more comprehensive and accurate model of electron transfer through the NQR complex .

What are promising applications of recombinant Pseudomonas stutzeri NqrE in bioelectrochemical systems?

Recombinant Pseudomonas stutzeri NqrE, as part of the Na+-NQR complex, presents several promising applications in bioelectrochemical systems:

  • Biosensors for electron transfer studies:

    • Integration into electrode systems for real-time monitoring of electron transfer

    • Development of Na+ sensing platforms based on NQR activity

    • Creation of redox-responsive biosensors for environmental monitoring

  • Bioenergy applications:

    • Engineering of microbial fuel cells with enhanced electron transfer capabilities

    • Development of bioelectrosynthesis systems utilizing Na+ gradients

    • Creation of artificial photosynthetic systems incorporating NQR components

  • Biotransformation platforms:

    • Coupling NQR activity to biocatalytic reactions requiring redox cofactors

    • Engineering of whole-cell catalysts with improved redox balancing

    • Development of systems for the reduction of challenging substrates

These applications would benefit from the unique properties of Na+-NQR, particularly its ability to couple electron transfer to Na+ translocation, potentially providing advantages in environments where proton gradients are less efficient. The implementation of these systems would require detailed understanding of the electron transfer mechanisms within the NQR complex and optimization of the interface between the biological components and electrodes .

How might structural biology techniques advance our understanding of Na(+)-translocating NQR complexes?

Advanced structural biology techniques have tremendous potential to enhance our understanding of Na(+)-translocating NQR complexes:

  • Cryo-electron microscopy (cryo-EM):

    • Determination of the complete Na+-NQR complex structure at high resolution

    • Visualization of conformational changes during the catalytic cycle

    • Identification of Na+ binding sites and translocation pathway

  • Integrative structural biology:

    • Combining X-ray crystallography of individual domains with cryo-EM of the complex

    • Incorporation of mass spectrometry data for identifying protein-protein interactions

    • Integration of computational modeling to predict dynamic behavior

  • Time-resolved structural methods:

    • Application of time-resolved X-ray techniques to capture reaction intermediates

    • Development of temperature-jump methods coupled with structural analysis

    • Implementation of microfluidic mixing devices for capturing short-lived states

  • In situ structural studies:

    • Development of methods to study membrane protein complexes in native-like environments

    • Application of solid-state NMR to study membrane-embedded components

    • Use of neutron diffraction to locate Na+ ions within the complex

Recent advances in membrane protein structural biology, particularly in cryo-EM, make it increasingly feasible to determine the structure of challenging membrane protein complexes like Na+-NQR. Obtaining a high-resolution structure would provide crucial insights into the Na+ translocation mechanism, the arrangement of redox cofactors, and the basis for ion selectivity .

What genome engineering approaches could enhance our understanding of NQR function in bacterial physiology?

Genome engineering approaches offer powerful tools for investigating NQR function in bacterial physiology:

  • CRISPR-Cas9 genome editing:

    • Precise modification of nqr genes in their native context

    • Introduction of point mutations to test specific mechanistic hypotheses

    • Creation of conditional knockout systems to study essentiality under different conditions

  • Synthetic biology approaches:

    • Reconstruction of minimal nqr operons with defined components

    • Development of orthogonal expression systems for controlled studies

    • Creation of chimeric complexes to test subunit compatibility across species

  • Reporter systems:

    • Integration of fluorescent or luminescent reporters to monitor nqr expression

    • Development of redox-sensitive reporters to track electron flow in vivo

    • Creation of Na+-sensitive biosensors to monitor NQR activity in real-time

  • High-throughput phenotyping:

    • Transposon mutagenesis coupled with next-generation sequencing (Tn-Seq)

    • Creation of comprehensive single amino acid substitution libraries

    • Development of growth-based selection systems for functional NQR variants

  • Systems biology integration:

    • Multi-omics approaches to understand NQR in the context of global metabolism

    • Flux balance analysis to quantify the contribution of NQR to cellular energetics

    • Interaction network mapping to identify proteins that functionally interact with NQR

These approaches would allow researchers to move beyond traditional genetic knockouts and provide nuanced understanding of how NQR function integrates with broader aspects of bacterial physiology, potentially revealing unexpected roles in processes like stress response, pathogenicity, and adaptation to changing environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.