Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC)

Shipped with Ice Packs
In Stock

Description

Genetic Organization and Denitrification Gene Cluster

NorC is encoded by the norC gene, which resides in a 30-kb denitrification gene cluster alongside norB, nir (nitrite reductase), and nos (nitrous oxide reductase) genes . Key features include:

  • Operon structure: norC and norB form the norCB operon, transcribed in the same direction as adjacent nir genes .

  • Regulatory proximity: The nor and nir subclusters are nearly contiguous, suggesting synchronized expression to prevent cytotoxic NO accumulation .

Table 1: Genetic Context of norC in P. stutzeri

Gene ClusterFunctionKey GenesRegulatory Elements
norCBNO reductionnorC, norBAnaerobically regulated promoters, Fnr-binding motifs
nirSTBNitrite reductionnirS, nirT, nirBNO-responsive DnrD regulator
nosZN₂O reductionnosZRequires N₂O and NO signals

Regulatory Mechanisms

NorC expression is tightly controlled by environmental signals and transcriptional regulators:

  • Induction by NO: Nanomolar NO concentrations (≥5 nM) activate norCB transcription via the DnrD regulator, while higher concentrations (>50 nM) suppress it .

  • Anaerobic regulation: The FnrA protein (an FNR-CRP family regulator) binds to promoter motifs upstream of norCB under low oxygen conditions .

Table 2: Key Regulatory Factors for norC Expression

RegulatorFunctionSignalTarget Genes
DnrDNO-responsive activatorNO (5–50 nM)norCB, nirSTB
FnrAOxygen sensorLow O₂norCB, nosZ
NarXLNitrate/nitrite sensorNO₃⁻/NO₂⁻Indirect via DnrD

Protein Interaction Network

NorC integrates into a multi-enzyme complex essential for denitrification efficiency:

  • Core interactions:

    • NorB: Forms the catalytic core of NOR, receiving electrons from NorC .

    • NirM (cytochrome c₅₅₁): Direct electron donor to NorC .

  • Peripheral interactions:

    • NosR: Links NOR to nitrous oxide reductase (NosZ) via NorC .

    • NirN/NirQ: Assist in heme d₁ insertion and post-translational activation .

Biotechnological Applications

Recombinant NorC has potential uses in:

  • Bioremediation: Engineered strains could mitigate NO toxicity in industrial wastewater .

  • Bioenergy: Optimizing denitrification pathways for microbial fuel cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
norC; Nitric oxide reductase subunit C; NOR small subunit; Nitric oxide reductase cytochrome c subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-146
Protein Length
Full Length of Mature Protein
Species
Pseudomonas stutzeri (Pseudomonas perfectomarina)
Target Names
norC
Target Protein Sequence
SETFTKGMARNIYFGGSVFFFLVFLGLTYHTEQTFPERTNESEMTEAVVRGKEVWENNNC IGCHSLLGEGAYFAPELGNVFVRRGGEETFKPFLHAWMKAQPLGAPGRRAMPQFNLSEQQ VDDMAEFLKWTSKIDTNDWPPNKEG
Uniprot No.

Target Background

Function
A component of the anaerobic respiratory chain responsible for the transformation of nitrate to dinitrogen (denitrification).
Subcellular Location
Cell membrane; Single-pass membrane protein. Note=May be attached to the membrane by a signal-anchor.

Q&A

What is Pseudomonas stutzeri nitric oxide reductase subunit C (norC) and what is its role in denitrification?

Nitric oxide reductase subunit C (norC) is the cytochrome c component of the membrane-bound nitric oxide reductase complex in the anaerobic respiratory chain of Pseudomonas stutzeri. The enzyme catalyzes the reduction of nitric oxide (NO) to nitrous oxide (N₂O) as part of the denitrification pathway . The norC subunit functions alongside the norB subunit (cytochrome b) to form a functional enzyme complex that is integral to the conversion of nitrate to dinitrogen .

The denitrification pathway in P. stutzeri consists of four sequential reduction steps:

  • NO₃⁻ → NO₂⁻ (nitrate to nitrite, catalyzed by nitrate reductase)

  • NO₂⁻ → NO (nitrite to nitric oxide, catalyzed by nitrite reductase)

  • NO → N₂O (nitric oxide to nitrous oxide, catalyzed by NO reductase)

  • N₂O → N₂ (nitrous oxide to dinitrogen, catalyzed by N₂O reductase)

The norC-norB complex specifically catalyzes the third step, which is crucial for preventing the accumulation of toxic NO in the cell .

What is the structural organization of the norC gene in P. stutzeri?

The norC gene is organized in an operon structure with norB. Both genes are contiguous and transcribed as a single 2.0-kb transcript . The promoter region contains a canonical recognition motif for the transcriptional activator protein Fnr, centered at -40.5 nucleotides from the transcription initiation site . This organization is consistent with the coordinated expression of these genes, as both subunits are required for the formation of a functional NO reductase enzyme.

In the genome, the norCB operon is part of the larger denitrification gene cluster in P. stutzeri, which includes genes encoding other enzymes in the pathway, such as nitrate reductase (nar), nitrite reductase (nir), and nitrous oxide reductase (nos) .

What are the molecular characteristics of the norC protein?

The norC gene encodes a cytochrome c protein with the following characteristics:

PropertyValue
Full protein length145 amino acids (after processing)
Molecular weight16,508 Da (mature form)
Post-translational processingRemoval of terminal methionine to leave N-terminal serine
Membrane topologyBitopic protein with a single membrane anchor
Cofactorc-type heme
FunctionElectron transfer component of NO reductase

The mature norC subunit functions as a bitopic protein with a single membrane anchor, positioning it appropriately to interact with the norB subunit and facilitate electron transfer during NO reduction .

How is norC expression regulated in P. stutzeri?

The expression of norC is regulated through multiple mechanisms:

  • Transcriptional activation by NO: Transcription of the norCB operon is activated by low concentrations (5-50 nM) of nitric oxide, which serves as a signaling molecule .

  • DNR-dependent regulation: The transcription factor DnrD, a member of the FNR-CRP family, is part of the NO-triggered signal transduction pathway that regulates norC expression .

  • Anoxic conditions: Expression is induced under anaerobic conditions, consistent with the role of denitrification as an anaerobic respiratory pathway .

  • Coordination with other denitrification enzymes: There is evidence of coordinated regulation between the nitrite-reducing system and the NO-reducing system. Inactivation of nitrite reductase (nirS) or loss of nitrite reduction lowers the expression level of NO reductase to 5-20% .

  • Autoregulation: NO appears to be required as an inducer for its own reductase, creating a feedback loop in the regulation system .

What experimental approaches can be used to study the structure-function relationship of recombinant norC?

Several experimental approaches can be employed to investigate the structure-function relationship of recombinant norC:

  • X-ray crystallography and cryo-EM: These techniques can provide high-resolution structural information about norC alone or in complex with norB. Sample preparation typically involves:

    • Expression of recombinant norC with appropriate tags

    • Membrane extraction using detergents

    • Purification via affinity chromatography

    • Crystallization trials or grid preparation for cryo-EM

  • Site-directed mutagenesis: Strategic mutation of conserved residues can reveal their functional importance. Key targets include:

    • Heme-binding motifs (CXXCH)

    • Charged residues at the predicted norB interface

    • Residues in the predicted membrane-spanning domain

  • Spectroscopic analysis: Various spectroscopic techniques can provide information about the heme environment and electron transfer properties:

    • UV-visible spectroscopy to characterize the heme

    • EPR spectroscopy to study the electronic structure

    • Resonance Raman spectroscopy to investigate heme-protein interactions

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify specific residues involved in interactions between norC and norB or other proteins in the denitrification pathway .

  • Molecular dynamics simulations: Computational approaches can model the dynamics of norC in a membrane environment and predict structural changes during catalysis or electron transfer.

What methodologies can be used to optimize the expression of recombinant norC in heterologous systems?

Optimizing the expression of membrane proteins like norC presents significant challenges. Key methodologies include:

  • Host selection: Several expression systems can be considered:

    Expression SystemAdvantagesDisadvantages
    E. coliFast growth, well-established protocolsMay lack proper folding machinery for P. stutzeri proteins
    P. stutzeriNative environment for foldingSlower growth, fewer genetic tools available
    P. aeruginosaRelated species, similar membrane environmentPathogenic, may require specialized containment
    Yeast (S. cerevisiae)Eukaryotic folding machineryDifferent membrane composition
    Cell-free systemsControl over reaction environmentLimited yield for membrane proteins
  • Codon optimization: Adapting the norC coding sequence to the codon usage bias of the host organism can improve translation efficiency.

  • Fusion tags and partners: Various fusion strategies can enhance expression and solubility:

    • His-tag for purification

    • MBP (maltose-binding protein) or SUMO for solubility enhancement

    • Signal sequences for proper membrane targeting

  • Growth conditions optimization:

    • Temperature (typically lowered to 16-25°C to slow expression and aid folding)

    • Induction timing and inducer concentration

    • Media composition, including addition of heme precursors for cytochrome production

    • Anaerobic or microaerobic conditions to mimic the native environment of norC

  • Co-expression strategies:

    • Co-expressing norB with norC to promote proper complex formation

    • Co-expressing chaperones to aid folding

    • Co-expressing cytochrome c maturation proteins (Ccm system) to ensure proper heme incorporation

What techniques can be employed to assess the enzymatic activity of recombinant norC-norB complex?

Assessment of NO reductase activity requires specialized techniques due to the gaseous nature of the substrate and product. Methods include:

  • Gas chromatography: Measuring the consumption of NO or production of N₂O gas.

  • Clark-type electrodes: Modified to detect NO consumption in real-time.

  • Spectrophotometric assays: Following the oxidation state of electron donors:

    • Monitoring reduced cytochrome c oxidation

    • Using artificial electron donors like methyl viologen or benzyl viologen

  • NO-sensitive fluorescent probes: For in vivo activity measurements in whole cells.

  • Isotope labeling: Using ¹⁵N-labeled substrates and mass spectrometry to track nitrogen atom fate.

A typical protocol for measuring NO reductase activity includes:

  • Preparation of anaerobic buffer in sealed vessels

  • Addition of purified enzyme or membrane preparations

  • Introduction of electron donors

  • Injection of NO solution at known concentration

  • Time-course sampling for product formation or substrate consumption

  • Analysis by appropriate detection method

How does norC interact with norB to form a functional NO reductase complex?

The interaction between norC and norB is essential for the formation of a functional NO reductase complex. Key aspects of this interaction include:

  • Structural basis: The mature norC subunit (16,508 Da, 145 residues) is a bitopic protein with a single membrane anchor, while the norB subunit (53,006 Da, 473 residues) is a polytopic membrane protein with 12 potential transmembrane segments . This arrangement suggests that norC is located at the periplasmic side of the membrane, interacting with norB through specific domains.

  • Electron transfer pathway: The c-type heme in norC likely accepts electrons from periplasmic electron donors and transfers them to the b-type heme in norB, which then passes them to the catalytic center for NO reduction.

  • Conserved residues: Several histidine and proline residues have been identified as potentially important for the structural and functional interaction between norC and norB .

  • Experimental evidence: Mutational studies have shown that deletion of either norB or the entire norCB operon affects not only NO reduction but also influences the activity of other enzymes in the denitrification pathway, particularly nitrite reductase . This suggests a physical or regulatory connection between these enzyme complexes.

  • Membrane topology models: Based on sequence analysis and experimental data, models suggest that norC interacts with norB through specific charged residues at the membrane interface, providing a stable complex that properly positions the cofactors for efficient electron transfer .

How can site-directed mutagenesis be used to investigate key residues in norC?

Site-directed mutagenesis is a powerful approach to investigate the functional importance of specific residues in norC. A comprehensive mutagenesis strategy might include:

  • Identification of target residues:

    • Conserved residues identified through multiple sequence alignments of norC proteins from different bacteria

    • Residues predicted to be involved in heme binding (e.g., the CXXCH motif)

    • Charged residues at predicted protein-protein interfaces

    • Residues in the membrane-spanning domain

    • Histidine residues that might participate in electron transfer or proton translocation

  • Types of mutations to consider:

    • Conservative substitutions (e.g., Asp to Glu) to test the importance of specific functional groups

    • Non-conservative substitutions to drastically alter the property of a residue

    • Alanine scanning to remove side chain functionality while maintaining structure

    • Introduction of reporter groups for spectroscopic analysis

  • Functional assays:

    • Enzyme activity measurements to assess the impact on catalysis

    • Spectroscopic analysis to detect changes in the heme environment

    • Protein-protein interaction assays to evaluate effects on complex formation

    • Stability assays to determine effects on protein folding and membrane integration

  • Example mutagenesis targets in norC:

    Residue TypePotential FunctionMutagenesis Strategy
    CXXCH motifHeme bindingC→A to prevent heme attachment
    Charged residues (D, E, K, R)Protein-protein interactionsCharge reversal (D→K) to disrupt interactions
    Membrane-spanning hydrophobic residuesMembrane anchoringPolar substitutions to affect membrane insertion
    Histidine residuesElectron/proton transferH→A to remove imidazole functionality
    Conserved prolinesStructural turnsP→A to increase flexibility
  • Analysis of mutant phenotypes: Correlating biochemical data with structural models to develop a comprehensive understanding of structure-function relationships in norC .

How can protein-protein interactions between norC and other denitrification enzymes be studied?

Investigating protein-protein interactions involving membrane proteins like norC presents unique challenges. Several techniques can be applied:

  • Co-immunoprecipitation (Co-IP): Using antibodies against norC or epitope tags to pull down interacting proteins from solubilized membranes, followed by mass spectrometry to identify binding partners.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these genetic systems can detect interactions in vivo by reconstituting a transcription factor or other reporter when two proteins interact.

  • Cross-linking coupled with mass spectrometry (XL-MS): Chemical cross-linkers can capture transient interactions between norC and other proteins, and mass spectrometry can identify the cross-linked peptides, providing spatial constraints for the interaction.

  • Förster Resonance Energy Transfer (FRET): Fluorescent protein fusions to norC and potential interaction partners can reveal proximity in the native membrane environment.

  • Surface Plasmon Resonance (SPR): Purified norC can be immobilized on a sensor chip, and potential binding partners flowed over to detect interactions in real-time.

  • Blue Native PAGE: This technique can preserve native protein complexes during electrophoresis, allowing the identification of norC-containing complexes.

  • Proteomic analysis of membrane fractions: Comparing the proteome of membrane fractions from wild-type and norC deletion mutants can identify proteins whose membrane association depends on norC.

  • Genetic suppressor screens: Identifying mutations that suppress the phenotype of norC mutations can reveal functional interactions.

Potential interaction partners to investigate include:

  • Other components of the denitrification pathway (NirS, NosZ)

  • Electron transport proteins (cytochromes, etc.)

  • Regulatory proteins (DnrD and related factors)

  • Membrane assembly and stabilization factors

What molecular mechanisms regulate the transcriptional activation of norC by nitric oxide?

The transcriptional activation of norC by nitric oxide involves a sophisticated regulatory network:

  • NO sensing mechanism: NO is sensed by specific regulatory proteins, likely involving metal centers (iron-sulfur clusters or heme groups) that undergo conformational changes upon NO binding.

  • DnrD activation: The transcription factor DnrD, a member of the FNR-CRP family, appears to be activated in response to NO signals. Experimental evidence shows that:

    • Transcription of norCB is activated by 5-50 nM NO

    • NO modifies the transcriptional pattern of the dnrD operon by inducing the transcription of dnrN and dnrO, located upstream of dnrD

  • Promoter recognition: The promoter region of the norCB operon contains a canonical recognition motif for the transcriptional activator protein Fnr, centered at -40.5 nucleotides from the initiation site of transcription . DnrD likely binds to this or a similar motif to activate transcription.

  • Coordination with other signals: The NO-mediated activation of norC transcription is integrated with other regulatory signals, including:

    • Oxygen limitation (anaerobic conditions)

    • Nitrate/nitrite availability

    • General cellular energy status

  • Feedback regulation: The norC-norB complex reduces NO to N₂O, thereby decreasing NO levels. This creates a negative feedback loop where the activity of the enzyme can modulate its own expression by affecting the concentration of its transcriptional inducer .

Experimental evidence suggests a model where low concentrations of NO (5-50 nM) are sufficient to trigger the expression of norCB, which then prevents toxic accumulation of NO by reducing it to N₂O .

What is the recommended protocol for purifying active recombinant norC protein?

Purifying active norC protein requires careful attention to maintain the native structure and heme incorporation. A recommended protocol includes:

  • Expression system selection:

    • E. coli strains engineered to express cytochrome c maturation (ccm) genes

    • Expression under microaerobic conditions to facilitate proper heme incorporation

    • Co-expression with norB to promote complex formation

  • Cell lysis and membrane preparation:

    • Gentle cell disruption (e.g., French press or sonication)

    • Differential centrifugation to isolate membrane fractions

    • Resuspension in buffer containing glycerol as a stabilizer

  • Detergent solubilization:

    DetergentConcentrationAdvantages
    n-Dodecyl β-D-maltoside (DDM)1-2%Mild, preserves activity
    Digitonin1-2%Very mild, good for complexes
    CHAPS0.5-1%Good for membrane proteins

    Solubilization should be performed at 4°C with gentle stirring for 1-2 hours.

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Cytochrome c affinity columns

    • Washing with buffers containing low detergent concentrations (0.05-0.1%)

  • Size exclusion chromatography:

    • Final purification step to separate monomeric norC from aggregates

    • Analysis of oligomeric state and complex formation with norB

  • Quality control assessments:

    • UV-visible spectroscopy to confirm heme incorporation

    • SDS-PAGE and Western blotting

    • Mass spectrometry to confirm intact protein

    • Activity assays to verify functional state

  • Storage considerations:

    • Storage in buffer containing 10-20% glycerol

    • Flash freezing in liquid nitrogen

    • Storage at -80°C in small aliquots

How can researchers analyze the membrane topology of norC?

Determining the membrane topology of norC is crucial for understanding its structure-function relationship. Several complementary approaches can be employed:

  • Computational prediction:

    • Hydropathy analysis using algorithms such as TMHMM, Phobius, or MEMSAT

    • Prediction of signal peptides and membrane-spanning segments

  • Reporter fusion approaches:

    • PhoA (alkaline phosphatase) fusions: Active only when positioned in the periplasm

    • GFP fusions: Fluorescent only when positioned in the cytoplasm

    • LacZ (β-galactosidase) fusions: Active only when positioned in the cytoplasm

    • Construction of a series of truncated norC variants with reporters at the C-terminus

  • Protease accessibility:

    • Treatment of intact cells, spheroplasts, or inverted membrane vesicles with proteases

    • Analysis of protected fragments by mass spectrometry or Western blotting

    • Identification of accessible versus protected regions

  • Chemical modification:

    • Use of membrane-impermeable reagents to label exposed residues

    • Mass spectrometry to identify modified residues

    • Comparison of labeling patterns in intact cells versus disrupted membranes

  • Epitope mapping:

    • Introduction of epitope tags at various positions

    • Immunodetection to determine accessibility from different sides of the membrane

  • Cysteine scanning mutagenesis:

    • Introduction of cysteines at regular intervals throughout the sequence

    • Labeling with membrane-permeable and impermeable sulfhydryl reagents

    • Determination of accessibility patterns

Based on existing data, norC is predicted to be a bitopic protein with a single membrane anchor, with the majority of the protein, including the heme-binding domain, located on the periplasmic side of the membrane . This topology facilitates its interaction with periplasmic electron donors and with the membrane-embedded norB subunit.

What approaches can be used to study the electron transfer mechanism within the norC-norB complex?

Understanding the electron transfer mechanism within the norC-norB complex requires sophisticated biophysical and biochemical techniques:

  • Time-resolved spectroscopy:

    • Laser flash photolysis to initiate electron transfer

    • Monitoring changes in heme absorption spectra on microsecond to millisecond timescales

    • Determining electron transfer rates between different cofactors

  • EPR spectroscopy:

    • Characterization of the electronic structure of heme centers

    • Detection of radical intermediates during catalysis

    • Temperature-dependent measurements to probe different electronic states

  • Site-directed mutagenesis of electron transfer pathway:

    • Mutation of residues predicted to be involved in electron transfer

    • Measurement of effects on electron transfer rates and catalytic activity

    • Mapping of the electron transfer pathway

  • Redox potential measurements:

    • Determination of midpoint potentials of the various cofactors

    • Assessment of thermodynamic feasibility of electron transfer steps

    • Protein film voltammetry for direct electrochemical measurements

  • Computational modeling:

    • Molecular dynamics simulations to predict cofactor distances and orientations

    • Quantum mechanical calculations of electron transfer rates

    • Identification of key residues facilitating electron transfer

  • Cross-linking coupled with mass spectrometry:

    • Mapping of the interface between norC and norB

    • Identification of residues important for complex formation and electron transfer

  • Stopped-flow kinetics:

    • Rapid mixing of enzyme with substrates and electron donors

    • Measurement of pre-steady-state kinetics

    • Determination of rate-limiting steps in the catalytic cycle

The electron transfer pathway is thought to involve the c-type heme in norC accepting electrons from periplasmic donors, transferring them to the b-type heme in norB, which then delivers them to the catalytic center where NO reduction occurs .

How can researchers investigate the physiological electron donors to the norC-norB complex?

Identifying and characterizing the physiological electron donors to the norC-norB complex is essential for understanding its function in vivo:

  • Genetic approaches:

    • Construction of knockout mutants for candidate electron donor genes

    • Measurement of effects on NO reduction activity in vivo

    • Complementation studies to confirm specific roles

  • Biochemical reconstitution:

    • Purification of candidate electron donors (cytochromes, azurin, etc.)

    • In vitro activity assays with purified norC-norB complex

    • Determination of kinetic parameters (Km, kcat) for different donors

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of norC with candidate donors

    • Surface plasmon resonance to measure binding affinities

    • Cross-linking followed by mass spectrometry to identify interaction interfaces

  • Biophysical characterization:

    • Stopped-flow spectroscopy to measure electron transfer rates

    • Determination of redox potentials to assess thermodynamic feasibility

    • EPR spectroscopy to monitor changes in electronic structure during electron transfer

  • Comparative genomics:

    • Analysis of gene clusters containing norC-norB across different bacteria

    • Identification of conserved genes encoding potential electron donors

    • Correlation of donor presence with denitrification capabilities

In P. stutzeri, potential electron donors to the norC-norB complex include:

  • Cytochrome c552

  • Pseudoazurin

  • Other periplasmic c-type cytochromes

The specific interactions between these electron donors and norC are likely mediated by complementary surface charge distributions and specific recognition elements that ensure efficient electron transfer .

What are the current challenges in studying recombinant norC and how might they be addressed?

Research on recombinant norC faces several significant challenges:

  • Expression and purification difficulties:

    • Challenge: Membrane proteins like norC are often difficult to express in functional form.

    • Solution: Development of specialized expression hosts with enhanced membrane protein folding machinery and cytochrome c maturation systems.

  • Complex formation with norB:

    • Challenge: The functional enzyme requires proper assembly of norC with norB.

    • Solution: Co-expression strategies and novel detergent/nanodisc systems that preserve native-like membrane environments.

  • Structural characterization:

    • Challenge: Obtaining high-resolution structural data for membrane protein complexes.

    • Solution: Application of advances in cryo-EM and X-ray crystallography techniques optimized for membrane proteins.

  • Functional assays:

    • Challenge: Working with gaseous, reactive substrates like NO.

    • Solution: Development of more sensitive, real-time assays using NO-specific electrodes or fluorescent probes.

  • Physiological relevance:

    • Challenge: Connecting in vitro findings to in vivo function.

    • Solution: Development of cell-based assays and in vivo imaging techniques to monitor enzyme activity in native contexts.

  • Post-translational modifications:

    • Challenge: Ensuring proper heme incorporation and processing.

    • Solution: Better characterization of the cytochrome c maturation pathways and their optimization in heterologous expression systems.

Future directions may include the application of expanded genetic code technologies to incorporate non-standard amino acids for probing structure-function relationships and the development of high-throughput screening methods to identify variants with enhanced stability or activity .

How does research on P. stutzeri norC contribute to our understanding of denitrification in other bacteria?

Research on P. stutzeri norC has broader implications for understanding denitrification across bacterial species:

  • Comparative genomics insights:

    • P. stutzeri serves as a model organism for denitrification studies, with its norC-norB complex being representative of similar enzymes in other denitrifiers .

    • Genomic analyses reveal that P. stutzeri populations have a strongly clonal structure, with limited horizontal gene transfer between genomovars .

    • This clonality provides a stable genetic background for studying the evolution and adaptation of denitrification genes.

  • Regulatory mechanisms:

    • The NO-dependent regulation of norC expression in P. stutzeri has revealed signaling mechanisms likely conserved across denitrifying bacteria .

    • The role of transcription factors like DnrD in the FNR-CRP family provides insights into how bacteria coordinate the expression of denitrification enzymes to prevent accumulation of toxic intermediates.

  • Enzyme structure-function relationships:

    • Mechanistic studies of P. stutzeri norC-norB provide templates for understanding similar enzymes in pathogenic denitrifiers.

    • Conserved features identified in P. stutzeri norC can guide investigations in less-studied bacterial species.

  • Environmental adaptations:

    • P. stutzeri strains have been isolated from diverse environments, allowing studies of how denitrification enzymes adapt to different ecological niches .

    • The natural transformation capabilities of many P. stutzeri strains provide insights into the potential for horizontal transfer of denitrification genes in environmental settings.

  • Biotechnological applications:

    • Understanding the function and regulation of P. stutzeri norC contributes to the development of bioremediation strategies for nitrogen-polluted environments.

    • Engineered denitrification systems based on P. stutzeri norC could be used for wastewater treatment and mitigation of greenhouse gas emissions.

The comprehensive characterization of norC in P. stutzeri thus serves as a foundation for understanding denitrification across the bacterial domain, with implications for environmental, medical, and biotechnological applications .

What new methodologies might enhance our ability to study norC structure and function?

Emerging methodologies offer promising approaches to better understand norC structure and function:

  • Advanced structural biology techniques:

    • Cryo-electron tomography to visualize norC-norB complexes in their native membrane environment

    • Micro-electron diffraction (microED) for structure determination from small crystals

    • Integrative structural biology approaches combining multiple data sources (X-ray, NMR, cryo-EM, crosslinking-MS)

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational changes during catalysis

    • Atomic force microscopy to measure protein-protein interaction forces

    • Single-molecule enzymology to detect heterogeneity in catalytic behavior

  • Advanced spectroscopy:

    • Ultrafast time-resolved spectroscopy to capture short-lived intermediates

    • Advanced EPR techniques (ENDOR, ESEEM) for detailed electronic structure analysis

    • Two-dimensional infrared spectroscopy to probe dynamics and vibrations

  • Synthetic biology approaches:

    • Minimal synthetic membranes to reconstitute norC-norB function

    • Biosensor development using norC for NO detection

    • Cell-free expression systems optimized for membrane protein synthesis

  • Computational methods:

    • Machine learning for prediction of structure and function

    • Enhanced sampling molecular dynamics to explore conformational landscapes

    • Quantum mechanical/molecular mechanical (QM/MM) methods to model catalysis

  • Genetic tools:

    • CRISPR-Cas9 for precise genomic editing in P. stutzeri

    • High-throughput mutagenesis coupled with deep sequencing

    • In vivo proximity labeling to map the protein interaction network

These emerging methodologies promise to provide unprecedented insights into the molecular details of norC structure, dynamics, and function, potentially resolving longstanding questions about the mechanism of NO reduction and its regulation in denitrifying bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.