Recombinant Pseudomonas stutzeri Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pseudomonas stutzeri Prolipoprotein Diacylglyceryl Transferase (Lgt) is an enzyme critical for bacterial lipoprotein biosynthesis. Lgt catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, a vital step in post-translational modification. This enzyme is essential for membrane integrity and virulence in Gram-negative bacteria, making it a target for antibacterial research . The recombinant form of P. stutzeri Lgt enables detailed biochemical and structural studies, advancing applications in antimicrobial development and bacterial physiology.

Production and Purification

Recombinant P. stutzeri Lgt is typically expressed in Escherichia coli systems for high-yield production . Key production parameters include:

ParameterSpecification
Expression SystemE. coli
TagDetermined during production (commonly His-tag for purification)
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Biochemical Properties

Lgt operates via a two-step mechanism:

  1. Substrate Binding: Recognizes phosphatidylglycerol and prolipoproteins.

  2. Catalytic Transfer: Transfers diacylglyceryl to the thiol group of prolipoproteins, releasing glycerol phosphate .

Key Kinetic Features:

  • Optimal activity in neutral pH (7.0–7.5) .

  • Inhibited by compounds targeting the phosphatidylglycerol-binding site (e.g., G2823, IC₅₀ = 0.93 μM) .

Functional Role and Mechanisms

  • Essentiality: Lgt is indispensable for bacterial viability. Depletion in E. coli causes outer membrane destabilization and increased antibiotic susceptibility .

  • Pathogenesis: Lipoproteins modified by Lgt anchor to membranes, facilitating host-pathogen interactions and virulence .

  • Conservation: Homologs of P. stutzeri Lgt are present across Gram-negative and Gram-positive bacteria, underscoring its evolutionary significance .

Antibacterial Drug Development

  • Lgt inhibitors (e.g., G9066, IC₅₀ = 0.24 μM) show bactericidal activity against Acinetobacter baumannii and E. coli, validating Lgt as a druggable target .

  • Resistance mechanisms are less likely compared to downstream lipoprotein pathway inhibitors .

Industrial Biotechnology

  • P. stutzeri’s robustness as a host for membrane protein production enhances Lgt yield for large-scale applications .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
lgt; PST_0413; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVAIAIGPLQIHWYGLMYLIGIGGAWWLASLRVQRFAPEWPKDKLSDLVFWV AMGVIVGGRLGYVLFYDLAAYINQPSLILQVWKGGMSFHGGLIGVLLCSWIFARRNGKSF FELMDFIAPFVPIGLGAGRIGNFINAELWGKATDVPWAMVFPTDPQQLARHPSQLYQFAL EGVALFVILWLYSRKPRPTMAVSGLFAVCYGIFRFIVEFVRVPDAQLGYLAFGWLTMGQV LCIPMVLLGAGMIAWGYRREAGRAPA
Uniprot No.

Target Background

Function

This recombinant Pseudomonas stutzeri Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its functional role in bacteria?

Lgt is an integral membrane enzyme that catalyzes the first step in the post-translational lipid modification of bacterial lipoproteins. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins via formation of a thioether bond. This modification is essential for bacterial lipoprotein biogenesis, which plays crucial roles in bacterial growth and pathogenesis .

The importance of Lgt has been demonstrated through depletion studies in uropathogenic Escherichia coli, where Lgt depletion led to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics . Crystal structures of E. coli Lgt have revealed that the enzyme contains two substrate binding sites and functions through a mechanism whereby substrates and products enter and leave laterally relative to the lipid bilayer .

How does the structure of Lgt relate to its function?

The high-resolution crystal structures of E. coli Lgt (resolved at 1.9 Å and 1.6 Å) provide significant insights into the structure-function relationship of this enzyme. The structures reveal two binding sites that accommodate the phosphatidylglycerol substrate and the lipobox-containing peptide . Complementation studies with different Lgt mutant variants have identified critical residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer activity .

The structural data support a mechanism where both substrate and product (lipid-modified lipobox-containing peptide) enter and leave the enzyme laterally relative to the lipid bilayer . This lateral access model is consistent with the membrane-embedded nature of Lgt and its substrates, and provides a framework for understanding how the enzyme interacts with its lipid environment during catalysis.

Why is Pseudomonas stutzeri considered as an alternative host for recombinant membrane protein expression?

Pseudomonas stutzeri has emerged as a valuable alternative host for membrane protein expression due to several key advantages:

  • P. stutzeri belongs to biosafety level one, making it safe for routine laboratory use, despite being a close relative of the human pathogen P. aeruginosa .

  • It has growth characteristics comparable to E. coli, with similar doubling times and the ability to grow in both rich and minimal media, making it convenient for laboratory cultivation .

  • Most importantly, P. stutzeri has demonstrated success in expressing membrane proteins that are difficult to produce in E. coli. Studies have shown that out of 36 heterologous target proteins tested, 20 were produced at high yields in P. stutzeri .

  • Some membrane proteins show significantly better expression in P. stutzeri compared to E. coli, expanding the repertoire of production hosts for challenging membrane proteins .

The development of tools like the pL2020 vector allows researchers to test expression in both E. coli and P. stutzeri without additional cloning steps, facilitating a parallel screening approach to identify the optimal host for a given target protein .

What expression systems are most effective for producing recombinant Lgt from P. stutzeri?

For optimal expression of recombinant Lgt from P. stutzeri, researchers should consider the following methodological approaches:

  • Vector selection: The pL2020 broad-host-range vector has been specifically developed for protein expression in P. stutzeri . This vector allows testing in both P. stutzeri and E. coli without additional cloning steps, which is particularly valuable for comparative expression studies.

  • Promoter considerations: For membrane proteins like Lgt, moderate expression levels are often preferred to avoid toxicity and misfolding. Inducible promoters with tunable expression are recommended over strong constitutive promoters.

  • Growth and induction conditions: Based on P. stutzeri growth characteristics, optimal conditions include:

    ParameterRecommended RangeNotes
    Growth temperature20-30°CLower temperatures often improve membrane protein folding
    Induction phaseMid-log phase (OD600 0.6-0.8)Balances cell density with metabolic capacity
    Post-induction time4-16 hoursLonger times at lower temperatures
    Media typeLB or Asn minimal mediumP. stutzeri grows well in both rich and minimal media
  • Fusion partners: C-terminal GFP fusion can facilitate monitoring of folding status and expression levels in real-time, which is particularly valuable for membrane proteins like Lgt .

What are the most effective methods for purifying active Lgt from P. stutzeri?

Purification of membrane proteins like Lgt requires specialized approaches. Based on successful membrane protein purification strategies, the following methodology is recommended:

  • Membrane preparation:

    • Harvest cells and disrupt using French press or sonication in buffer containing protease inhibitors

    • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g)

    • Wash membranes to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents systematically; for Lgt, mild detergents like n-dodecyl-β-D-maltoside (DDM) are often effective

    • Typical detergent concentrations range from 1-2% for solubilization, reduced to 0.03-0.05% for purification

    • Include glycerol (10-20%) to enhance stability during solubilization

    • Maintain pH 7.5-8.0 and include sufficient salt (150-300 mM NaCl)

  • Chromatography strategy:

    • For His-tagged constructs, immobilized metal affinity chromatography is the primary step

    • Follow with size exclusion chromatography to remove aggregates and assess homogeneity

    • Consider ion exchange chromatography as an additional purification step if needed

  • Quality control assessments:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Enzymatic activity assay measuring glycerol phosphate release

    • Thermal stability assays to confirm proper folding

How can researchers assess the activity of purified recombinant Lgt?

A reliable activity assay is crucial for characterizing Lgt function. Based on established methods, the following approach can be used to assess Lgt activity:

  • Biochemical assay principle: Measure the release of glycerol phosphate, a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate .

  • Assay components:

    • Substrate: Phosphatidylglycerol with defined acyl chains

    • Peptide substrate: Derived from lipoproteins (e.g., Pal-IAAC, where C is the conserved cysteine modified by Lgt)

    • Detection system: Coupled enzymatic reaction for glycerol-3-phosphate detection linked to luciferase

  • Reaction conditions:

    • Buffer: Typically HEPES or Tris at pH 7.5-8.0

    • Salt: 100-200 mM NaCl

    • Detergent: At concentrations above CMC but below levels that interfere with the assay

    • Temperature: 30°C (can be adjusted based on the source organism)

  • Data analysis:

    • Generate dose-response curves for inhibitor testing

    • Calculate IC50 values for inhibitors using non-linear regression

    • For kinetic studies, determine Km and Vmax for both phosphatidylglycerol and peptide substrates

Example of Lgt activity data format:

SubstrateKm (μM)Vmax (nmol/min/mg)kcat (min⁻¹)kcat/Km (μM⁻¹min⁻¹)
Phosphatidylglycerol45 ± 5120 ± 103.60.08
Pal-IAAC peptide12 ± 2105 ± 83.20.27

How can structure-function studies be designed to identify critical residues in P. stutzeri Lgt?

Structure-function studies of P. stutzeri Lgt can be designed using the following methodological approach:

  • Sequence analysis and structural modeling:

    • Perform multiple sequence alignment of Lgt from various bacterial species

    • Identify conserved residues, particularly around the proposed active site

    • Generate a homology model based on the E. coli Lgt crystal structure (if P. stutzeri Lgt structure is unavailable)

    • Predict functional residues based on conservation and structural position

  • Site-directed mutagenesis strategy:

    • Target conserved residues in the predicted active site (based on E. coli Lgt, critical residues include Arg143 and Arg239)

    • Design alanine substitutions to eliminate side chain functionality

    • For charged residues, consider charge reversal mutations

    • Include mutations of residues predicted to interact with substrates

  • Functional complementation system:

    • Develop an lgt-depleted P. stutzeri strain using inducible systems

    • Transform with plasmids expressing wild-type or mutant Lgt variants

    • Assess growth rescue as a measure of functional complementation

    • Quantify relative fitness of each mutant

  • Biochemical characterization:

    • Purify each mutant protein using standardized protocols

    • Determine enzyme kinetics for wild-type and mutant enzymes

    • Compare substrate binding affinities

    • Assess thermal stability changes caused by mutations

This systematic approach allows for comprehensive mapping of structure-function relationships in P. stutzeri Lgt, providing insights into mechanism and potential species-specific features.

What approaches can be used to identify and characterize inhibitors of P. stutzeri Lgt?

The identification of Lgt inhibitors has potential antimicrobial applications. The following methodological framework can be used:

  • High-throughput screening approach:

    • Adapt the glycerol phosphate release assay to a microplate format

    • Optimize signal-to-noise ratio and Z' factor for robustness

    • Screen diverse compound libraries

    • Implement counter-screens to eliminate false positives

  • Hit validation and characterization:

    • Confirm hits using dose-response curves

    • Determine IC50 values and inhibition mechanisms

    • Assess specificity against related enzymes

    • Evaluate stability and solubility properties

  • Structure-activity relationship studies:

    • Synthesize analogs of confirmed hits

    • Test activity of structural variants

    • Identify key pharmacophore features

    • Optimize potency and physicochemical properties

  • Antibacterial evaluation:

    • Determine minimum inhibitory concentrations against P. stutzeri and other Gram-negative bacteria

    • Assess bactericidal versus bacteriostatic activity

    • Monitor effects on lipoprotein processing in vivo

    • Evaluate resistance development potential

Research has identified the first Lgt inhibitors that potently inhibit E. coli Lgt biochemical activity in vitro (IC50 values of 0.18-0.93 μM) and show bactericidal activity against wild-type A. baumannii and E. coli . These compounds can serve as starting points for developing inhibitors specific to P. stutzeri Lgt.

How does Lgt depletion or inhibition affect bacterial membrane integrity in P. stutzeri?

Understanding the consequences of Lgt inhibition is crucial for evaluating its potential as an antibacterial target. The following methodological approach can be used to study these effects:

  • Generation of tools for studying Lgt depletion:

    • Create an inducible lgt deletion strain in P. stutzeri

    • Develop systems for controlled Lgt expression

    • Adapt Lgt inhibitors for use with P. stutzeri

  • Membrane integrity assessments:

    • Measure outer membrane permeability using hydrophobic dye uptake assays

    • Assess sensitivity to detergents (SDS, Triton X-100)

    • Evaluate resistance to antibiotics that normally cannot penetrate intact membranes

    • Quantify release of periplasmic contents

  • Lipoprotein processing analysis:

    • Monitor accumulation of lipoprotein precursors by Western blotting

    • Analyze changes in lipoprotein localization

    • Examine effects on peptidoglycan-associated lipoproteins

    • Quantify changes in lipoprotein abundance using proteomics

  • Physiological impact assessment:

    • Determine effects on growth rate and viability

    • Assess morphological changes using microscopy

    • Evaluate sensitivity to serum killing as a measure of membrane integrity

    • Monitor resistance to osmotic and mechanical stress

Studies in E. coli have shown that Lgt depletion leads to outer membrane permeabilization, increased sensitivity to serum killing, and enhanced antibiotic susceptibility . Similar studies in P. stutzeri would provide valuable comparative data.

How do the enzymatic properties of P. stutzeri Lgt compare with those from other bacterial species?

Comparative analysis of Lgt from different bacterial species provides insights into conserved mechanisms and species-specific adaptations. The following methodological approach enables systematic comparison:

  • Standardized expression and purification:

    • Clone lgt genes from multiple species (P. stutzeri, E. coli, A. baumannii, etc.)

    • Express in the same host system under identical conditions

    • Purify using identical protocols to minimize methodology-induced variations

    • Verify comparable purity and stability

  • Enzymatic characterization under identical conditions:

    • Substrate specificity analysis using various phospholipids

    • Determination of kinetic parameters for both lipid and peptide substrates

    • pH and temperature activity profiles

    • Metal ion and salt dependencies

  • Inhibitor sensitivity profiling:

    • Test responses to known Lgt inhibitors

    • Determine IC50 values for each enzyme variant

    • Analyze structure-activity relationships across species

    • Identify species-specific inhibition patterns

  • Structural comparison:

    • Analyze sequence conservation in functional domains

    • Compare available crystal structures or homology models

    • Identify species-specific structural features

    • Correlate structural differences with functional variations

This systematic comparison would help identify conserved features essential for Lgt function across species as well as potential species-specific adaptations that might be exploited for selective inhibition.

What are the differences in substrate specificity between P. stutzeri Lgt and E. coli Lgt?

Understanding substrate specificity differences between Lgt from different bacterial species has implications for inhibitor design and evolutionary biology. The following methodology can be employed:

  • Lipid substrate preference analysis:

    • Test phosphatidylglycerol variants with different acyl chain compositions

    • Evaluate other phospholipids as potential substrates

    • Determine kinetic parameters for each substrate

    • Compare relative efficiencies (kcat/Km) across substrates

  • Peptide substrate specificity:

    • Synthesize peptides based on lipoprotein signal sequences from both organisms

    • Create peptide libraries with variations in the lipobox region

    • Measure activity with each peptide substrate

    • Identify sequence determinants for optimal recognition

  • Competitive substrate assays:

    • Perform assays with mixed substrates to detect preferences

    • Calculate selectivity indices for different substrate combinations

    • Determine if substrate preferences correlate with the native lipid environment

  • Structural basis for substrate preferences:

    • Identify residues lining the substrate binding pockets

    • Compare these residues between P. stutzeri and E. coli Lgt

    • Perform site-directed mutagenesis to convert specificity

    • Validate predictions using engineered enzymes

This comprehensive analysis would provide insights into the molecular basis of substrate recognition and potential adaptation to different membrane environments.

What are common challenges in expressing and purifying recombinant Lgt from P. stutzeri, and how can they be addressed?

Membrane proteins like Lgt present specific challenges during expression and purification. The following troubleshooting approaches address common issues:

  • Poor expression levels:

    • Challenge: Insufficient protein production

    • Solution: Optimize codon usage for P. stutzeri, test different promoter strengths, evaluate expression at lower temperatures (16-25°C), and consider co-expression with chaperones

    • Diagnostic: Monitor expression using Western blotting or GFP fusion fluorescence

  • Protein misfolding and aggregation:

    • Challenge: Protein forms insoluble aggregates

    • Solution: Reduce expression rate by lowering inducer concentration, express at lower temperatures, optimize membrane insertion using appropriate signal sequences

    • Diagnostic: Compare detergent-soluble versus insoluble fractions by Western blotting

  • Toxicity to host cells:

    • Challenge: Expression causes growth arrest or cell death

    • Solution: Use tightly controlled inducible systems, reduce expression levels, optimize induction timing based on growth curves

    • Diagnostic: Monitor growth curves with and without induction

  • Low purification yields:

    • Challenge: Significant loss during purification steps

    • Solution: Optimize solubilization conditions (detergent type, concentration, time), test various affinity tags and positions, implement gentle purification strategies

    • Diagnostic: Track protein through each purification step to identify where losses occur

These approaches should be systematically tested to develop an optimized protocol specific for P. stutzeri Lgt production.

How can researchers address inconsistent results in Lgt activity assays?

Biochemical assays for membrane enzymes like Lgt can yield variable results. The following methodological approaches improve consistency:

  • Enzyme preparation considerations:

    • Standardize purification protocols rigorously

    • Determine protein concentration using multiple methods

    • Verify enzyme homogeneity by size exclusion chromatography

    • Prepare single-use aliquots to avoid freeze-thaw cycles

  • Substrate quality control:

    • Use highly pure phospholipid substrates (>95% purity)

    • Verify peptide substrate integrity by mass spectrometry

    • Prepare fresh substrate stocks for each experiment series

    • Store lipids under nitrogen to prevent oxidation

  • Assay component standardization:

    • Prepare master mixes for reagents to minimize pipetting errors

    • Control temperature precisely during reactions

    • Include internal standards in coupled enzyme assays

    • Use the same batch of critical reagents for comparative studies

  • Data analysis protocols:

    • Establish clear criteria for data inclusion/exclusion

    • Perform appropriate blank corrections

    • Use curve fitting tools designed for enzyme kinetics

    • Include positive controls in each assay

By implementing these systematic approaches, researchers can significantly improve the reproducibility and reliability of Lgt activity assays.

What are promising approaches for studying the membrane environment's influence on P. stutzeri Lgt activity?

As an integral membrane enzyme, Lgt function is likely influenced by its lipid environment. The following methodological approaches can elucidate these relationships:

  • Reconstitution in defined lipid environments:

    • Purify Lgt in detergent

    • Reconstitute into proteoliposomes with defined lipid compositions

    • Systematically vary phospholipid head groups, acyl chain lengths, and membrane fluidity

    • Measure enzymatic activity in different lipid contexts

  • Native membrane studies:

    • Modify cellular lipid composition through genetic manipulation

    • Grow cells with different fatty acid supplements

    • Analyze Lgt activity in these modified membranes

    • Correlate membrane physical properties with enzyme activity

  • Biophysical characterization of lipid-protein interactions:

    • Use fluorescence spectroscopy with labeled lipids or protein

    • Employ electron paramagnetic resonance to measure lipid dynamics around protein

    • Perform differential scanning calorimetry to analyze thermodynamic parameters

    • Use atomic force microscopy to study membrane organization

  • Molecular dynamics simulations:

    • Build models of P. stutzeri Lgt in various lipid bilayers

    • Simulate protein-lipid interactions over time

    • Identify potential lipid binding sites

    • Predict how lipid composition affects protein conformational dynamics

These approaches would provide valuable insights into how the membrane environment modulates Lgt function, which could inform both basic understanding and inhibitor design.

What new technologies could advance our understanding of Lgt function in P. stutzeri?

Emerging technologies offer new opportunities to study membrane proteins like Lgt. The following methodological approaches represent promising future directions:

  • Cryo-electron microscopy:

    • Advantages: Allows visualization of membrane proteins in near-native environments

    • Application: Determine P. stutzeri Lgt structure in nanodiscs or native membranes

    • Technical considerations: Sample preparation optimization, image processing for smaller proteins

    • Expected outcomes: High-resolution structures in different conformational states

  • Mass spectrometry-based approaches:

    • Advantages: Can identify post-translational modifications and protein-lipid interactions

    • Application: Characterize the lipidome associated with Lgt, identify specific lipid interactions

    • Technical considerations: Gentle extraction procedures, specialized MS methods for lipids

    • Expected outcomes: Comprehensive map of Lgt-lipid interactions

  • In-cell NMR spectroscopy:

    • Advantages: Provides structural and dynamic information in a cellular context

    • Application: Study conformational changes during catalysis in living cells

    • Technical considerations: Isotope labeling strategies, sensitivity limitations

    • Expected outcomes: Dynamic picture of Lgt function in its native environment

  • CRISPR-based genetic screening:

    • Advantages: Genome-wide analysis of factors affecting Lgt function

    • Application: Identify cellular components that modulate Lgt activity

    • Technical considerations: Development of appropriate selection/screening strategies

    • Expected outcomes: Discovery of unknown regulatory mechanisms

These technologies would complement traditional biochemical approaches and potentially reveal new aspects of Lgt biology that could be exploited for therapeutic purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.