Recombinant Pseudomonas stutzeri Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant HtpX is produced in P. stutzeri using plasmid-based systems optimized for membrane protein expression . Key parameters include:

PropertyDetail
Expression HostPseudomonas stutzeri strain A1501
VectorpBBR1MCS derivatives with inducible promoters
TagStrep-tag II or His-tag (determined during production)
PurificationAffinity chromatography followed by size-exclusion chromatography
StorageTris-based buffer with 50% glycerol at -20°C or -80°C

Yields typically range from 2–5 mg per liter of culture under optimized microaerobic conditions .

Biochemical Properties

  • Enzyme Classification: EC 3.4.24.- (metalloprotease family) .

  • Substrate Specificity: Preferentially cleaves misfolded membrane proteins, analogous to HtpX homologs in P. aeruginosa .

  • Optimal Activity: Functions at pH 7.0–8.0 and 30–37°C, with dependence on Zn²⁺ ions .

Functional Role:

  • Degrades aberrant polypeptides under stress conditions (e.g., heat shock) .

  • Collaborates with other proteases (e.g., FtsH) to maintain membrane protein homeostasis .

Research Applications

Recombinant HtpX is utilized in:

  1. Antibiotic Resistance Studies:

    • In P. aeruginosa, HtpX contributes to intrinsic aminoglycoside resistance by degrading disruptive peptides . Similar mechanisms are hypothesized in P. stutzeri.

  2. Membrane Protein Quality Control:

    • Serves as a model system to study protease-substrate interactions in γ-proteobacteria .

  3. Biotechnological Tool:

    • Engineered variants are tested for industrial protein turnover applications due to thermostability .

Key Research Findings

  • Genetic Dependence: htpX expression is regulated by the phoBR operon under phosphate-limiting conditions, linking its activity to nutrient stress .

  • Functional Redundancy: In P. stutzeri, HtpX shares overlapping roles with HslVU and FtsH proteases, as shown by additive antibiotic sensitivity in multi-protease mutants .

  • Structural Insights: Crystallography of homologous HtpX proteins reveals a conserved catalytic core with flexible substrate-binding loops .

Future Directions

  • Mechanistic Studies: Elucidate substrate recognition patterns using cryo-EM.

  • Pathogen Targeting: Explore HtpX as a drug target in P. stutzeri-related infections.

  • Industrial Optimization: Improve expression yields via promoter engineering .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; PST_2539; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
htpX
Target Protein Sequence
MMRIFLFLATNLAVLVIASITLKLLGVDRYTGQNYGSLLVFCAVFGFAGSLISLFISKWM AKMSTRTEIISQPRTRHEQWLLQTVEQLSREAGIKMPEVGIFPAYEANAFATGWNRNDAL VAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGNFVDKA ILKNEDGHGIGYFVATIFAELVLGILASIIVMWFSRKREYRADEAGAQLAGTSAMIGALQ RLRAEQGLPVHMPDSLKAFGINGSLKHGMAGLFMTHPSLEDRIEALRQRG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas stutzeri Protease HtpX and what is its molecular role?

Pseudomonas stutzeri Protease HtpX (htpX) is a heat shock protein that functions as a transmembrane metalloprotease with a significant role in bacterial stress response mechanisms . The protein belongs to the M48 peptidase domain family and is evolutionarily conserved across various bacterial species . HtpX is notably preserved in both drug-resistant and drug-susceptible bacterial isolates, suggesting its fundamental importance in bacterial physiology beyond antimicrobial response pathways .

The full-length protein consists of 290 amino acids (1-290aa) and has been successfully expressed in recombinant systems with N-terminal His tags to facilitate purification and experimental manipulation . Functional studies indicate that HtpX participates in protein quality control mechanisms during stress conditions, likely through selective proteolytic activity against misfolded or damaged membrane proteins.

What expression systems are optimal for recombinant production of P. stutzeri Protease HtpX?

Several expression systems have been successfully utilized for the recombinant production of P. stutzeri Protease HtpX, with each offering distinct advantages depending on research objectives:

  • E. coli expression system: The most commonly used approach involves expressing the full-length P. stutzeri Protease HtpX (1-290aa) with an N-terminal His tag in E. coli . This system offers high yield and simplified purification protocols through affinity chromatography.

  • Bacillus subtilis WB800N: For enhanced production, the htpX gene has been cloned into vectors like pHT43 and transformed into B. subtilis WB800N . This expression system has demonstrated remarkable improvements in yield, with recombinant DX-3-htpX protease exhibiting a 61.9-fold increase in fermentation level compared to the native DX-3 protease .

The methodological approach typically involves:

  • PCR amplification of the htpX gene using primers containing appropriate restriction sites

  • Ligation into expression vectors (such as pHT43)

  • Transformation into an initial host (like E. coli DH5α) for plasmid propagation

  • Validation through bacterial PCR and sequencing

  • Transfer to expression hosts (E. coli BL21(DE3) or B. subtilis WB800N) for protein production

  • Induction with IPTG (typically at 1 mM when OD600 reaches 0.6-0.8)

  • Collection of fermentation supernatant after centrifugation

  • Protein analysis through SDS-PAGE and enzymatic assays

What are the recommended storage and handling protocols for maintaining Recombinant P. stutzeri Protease HtpX activity?

Optimal storage and handling of Recombinant P. stutzeri Protease HtpX is critical for maintaining its structural integrity and enzymatic activity. Based on established protocols, the following guidelines are recommended:

  • Storage temperature: Store at -20°C/-80°C upon receipt. For long-term storage, -80°C is preferable to minimize degradation .

  • Aliquoting: Division into small working aliquots is necessary to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

  • Reconstitution process:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended as default) for long-term storage

    • Aliquot and store at -20°C/-80°C

  • Buffer composition: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability .

  • Freeze-thaw considerations: Repeated freezing and thawing is strongly discouraged as it leads to protein denaturation and loss of activity .

How does metal binding affect the activity and structure of P. stutzeri Protease HtpX?

P. stutzeri Protease HtpX functions as a metalloprotease, with metal ion binding playing a crucial role in its enzymatic activity and structural integrity. Research findings indicate several key aspects of this relationship:

  • Metal dependency: As part of the M48 peptidase domain family, HtpX requires metal ions for catalytic activity . Studies have identified that HtpX functions as a zinc-dependent metalloprotease, with specific residues coordinating the zinc ion in the active site .

  • Calcium binding effects: Research on DX-3-htpX protease has demonstrated that Ca²⁺ binding significantly impacts the enzyme's structural configuration. Specifically, the binding of Ca²⁺ to the DX-3-htpX protease helps the protein attain its largest active pocket configuration, which is essential for optimal substrate recognition and catalytic efficiency .

  • Binding pocket analysis: Computational tools such as CASTpFold have been employed to analyze the D3 pocket and its binding to metal ions. This approach utilizes alpha shape and pocket algorithms from computational geometry to identify prominent concave protein regions associated with binding events. PyMOL visualization has further elucidated the tertiary structure of HtpX and its metal-binding sites .

  • Quantitative binding parameters: In the related NgHtpX (from N. gonorrhoeae), the zinc-binding potential has been quantified with a dissociation constant (Kd) of 0.4 μM using in vitro fluorescence quenching experiments .

Understanding these metal-binding properties provides valuable insights for designing experimental protocols that maintain optimal enzyme activity and for developing potential inhibitors targeting the metal-coordination sites.

What proteomics approaches are most effective for studying P. stutzeri Protease HtpX function and interactions?

Multiple proteomics approaches have been successfully applied to investigate P. stutzeri proteins, including HtpX, with each method offering distinct advantages:

  • Combined "bottom-up" and "top-down" approaches: Research has demonstrated that combining these complementary methods provides comprehensive protein identification and characterization. While bottom-up proteomics (also known as "shotgun" proteomics) digests intact proteins into peptides before MS analysis, the top-down approach analyzes intact proteins directly .

  • Direct-sequencing workflow: This approach offers significant advantages for identifying small proteins that would be difficult to detect after tryptic digest or digestion with other proteases. For P. stutzeri proteins, direct sequencing has demonstrated up to 100% higher sequence coverage and yielded more spectral counts compared to conventional methods .

  • Proteogenomics pipeline: Integrating proteomics data with genomic information has enabled the identification of novel proteoforms in P. stutzeri. This approach has successfully identified 2950 proteins in total—2921 known and 29 novel proteins .

  • Methodological considerations for HtpX analysis:

    • Due to HtpX's transmembrane nature, specialized extraction techniques may be required to solubilize the protein efficiently

    • Metal-sensitive detection methods should be employed to preserve the metalloprotease activity

    • Zymography analysis can be useful for detecting proteolytic activity in gel-based systems

    • SDS-PAGE analysis under various conditions can help evaluate protein expression levels and purity

For comprehensive analysis of HtpX function, a multi-method approach is recommended, combining both structural characterization and functional assays to elucidate its precise role in P. stutzeri physiology.

How can structural analysis of P. stutzeri Protease HtpX inform inhibitor design for antimicrobial applications?

Structural analysis of P. stutzeri Protease HtpX provides crucial insights for rational inhibitor design, with significant implications for antimicrobial development:

  • Conservation-based targeting: HtpX has been identified as a completely conserved protein in both drug-resistant and susceptible bacterial isolates, making it an attractive target for broad-spectrum antimicrobial development . This conservation suggests that resistance mutations might be less likely to emerge against HtpX-targeted therapeutics.

  • Active site mapping: Detailed structural analysis has identified critical residues involved in catalytic activity. For instance, in the related NgHtpX, the zinc-binding residue was mapped to E141 . These active site features provide specific structural targets for inhibitor design.

  • Binding pocket characterization: Computational tools like CASTpFold have been used to analyze binding pockets, which can inform structure-based drug design. The D3 pocket analysis reveals concave regions frequently associated with binding events that can be exploited for inhibitor development .

  • High-throughput screening approach: A composite high-throughput screening strategy followed by molecular dynamics simulations has successfully identified potential inhibitors. For example, pemirolast and thalidomide were identified as high-energy binding ligands for NgHtpX, with dissociation constants of 3.47 μM and 1.04 μM, respectively .

  • Functional validation: The identified ligands demonstrated dose-dependent reduction in bacterial viability when tested on cultures, validating the approach of targeting HtpX for antimicrobial development .

The structural knowledge of HtpX provides a foundation for developing inhibitors that could potentially address the growing challenge of multidrug-resistant and extremely drug-resistant pathogens, offering a novel approach to antimicrobial therapy.

What is the comparative analysis of HtpX conservation across different bacterial species and its implications?

HtpX demonstrates remarkable evolutionary conservation across diverse bacterial species, providing insights into its fundamental biological importance:

  • Conservation pattern: Genomic analysis has identified HtpX as a highly conserved protein across multiple bacterial species, including but not limited to Pseudomonas stutzeri, Neisseria gonorrhoeae, and Escherichia coli . This conservation extends across both Gram-negative and Gram-positive bacteria.

  • Conserved domains: The M48 peptidase domain found in P. stutzeri HtpX is highly conserved across bacterial species, suggesting this functional domain is essential for bacterial survival or fitness .

  • Role in antimicrobial resistance: Whole genome comparison and Shannon entropy analysis of N. gonorrhoeae identified HtpX as completely conserved in both drug-resistant and susceptible isolates, contrasting with highly variable amino acid positions in known antibiotic target genes like penA, ponA, 23s rRNA, rpoB, gyrA, parC, mtrR and porB .

  • Functional implications: The high degree of conservation suggests that HtpX plays a critical role in bacterial physiology that transcends species-specific adaptations. This likely relates to fundamental cellular processes such as protein quality control, stress response, or membrane protein homeostasis .

  • Therapeutic potential: The conservation of HtpX across diverse bacterial species, particularly in pathogens with different resistance profiles, positions it as a promising broad-spectrum antimicrobial target. Inhibitors designed against conserved structural features of HtpX could potentially be effective against multiple bacterial pathogens .

This evolutionary conservation analysis provides a strong rationale for focusing on HtpX as both a subject of fundamental research into bacterial physiology and as a target for novel antimicrobial development.

What experimental considerations are important when evaluating P. stutzeri Protease HtpX enzymatic properties?

When conducting enzymatic characterization of P. stutzeri Protease HtpX, several critical experimental considerations must be addressed to ensure reliable and reproducible results:

  • Metal ion dependency: As a metalloprotease, proper experimental design must account for the metal ion requirements of HtpX. Experiments should:

    • Control for metal ion availability in buffers

    • Evaluate activity with different metal ions (particularly Zn²⁺ and Ca²⁺)

    • Consider using chelating agents (EDTA, EGTA) as controls to confirm metal dependency

  • Buffer and pH conditions: The DX-3-htpX protease has been characterized as neutral and heat-resistant, indicating that:

    • pH optimization experiments should focus on the neutral range

    • Temperature stability assays should evaluate activity across a broad temperature range

    • Buffer composition should minimize interference with metal coordination

  • Substrate selection: Appropriate substrate selection is crucial for accurate activity assessment:

    • Consider using fluorogenic or chromogenic peptide substrates that target M48 peptidase specificity

    • Include control proteases with known activity for comparative analysis

    • Evaluate multiple substrate types to characterize the enzyme's specificity profile

  • Experimental replication: All experiments should be conducted in triplicate, with results reported as mean values ± standard deviation to ensure statistical validity .

  • Recombinant vs. native enzyme considerations: When using recombinant HtpX:

    • The impact of fusion tags (such as His-tags) on activity should be evaluated

    • Expression system artifacts should be controlled for

    • Post-translational modifications present in native but not recombinant forms should be considered

  • Data analysis: Appropriate analytical methods are essential:

    • Line graphs generated using software like Origin 2021 can effectively visualize enzymatic kinetics

    • Statistical analysis should be applied to determine significance of observed differences

    • Kinetic parameters (Km, Vmax, kcat) should be calculated when possible

Following these experimental considerations will help ensure that enzymatic characterization of P. stutzeri Protease HtpX generates reliable data that accurately reflects the protein's true functional properties.

How can recombinant P. stutzeri Protease HtpX be effectively purified for structural studies?

Purification of recombinant P. stutzeri Protease HtpX for structural studies requires specialized approaches to maintain protein integrity while achieving high purity. The following methodology has proven effective:

  • Expression optimization:

    • Select an appropriate expression system (E. coli or B. subtilis WB800N)

    • Optimize induction conditions with IPTG (typically 1 mM when culture reaches OD600 of 0.6-0.8)

    • Consider temperature reduction during expression to improve protein folding

  • Initial purification:

    • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC)

    • Harvest cells and resuspend in appropriate lysis buffer containing protease inhibitors

    • For membrane-associated HtpX, include detergents like n-dodecyl β-D-maltoside (DDM) or Triton X-100 to solubilize the protein

    • Apply cleared lysate to Ni-NTA or similar matrix

    • Wash extensively to remove non-specific binding

    • Elute with imidazole gradient or step elution

  • Secondary purification:

    • Consider size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography may further improve purity

    • For structural studies, detergent exchange may be necessary to find optimal conditions for crystallization or cryo-EM

  • Quality assessment:

    • Evaluate purity by SDS-PAGE (>90% purity is recommended for structural studies)

    • Verify identity by western blotting or mass spectrometry

    • Assess homogeneity by dynamic light scattering or analytical size exclusion

  • Buffer optimization for structural studies:

    • Screen multiple buffer conditions for stability

    • Consider including glycerol (5-50%) to prevent aggregation

    • For crystallography, perform thermal shift assays to identify stabilizing conditions

    • For membrane proteins like HtpX, lipid or nanodisc reconstitution may improve stability

  • Special considerations for metalloprotease:

    • Supplement buffers with appropriate metal ions (Zn²⁺ or Ca²⁺)

    • Avoid chelating agents like EDTA in final buffer formulations

    • Consider activity assays to confirm that purified protein retains functionality

Following this methodological approach will yield high-quality recombinant P. stutzeri Protease HtpX suitable for detailed structural investigations using X-ray crystallography, cryo-EM, or NMR spectroscopy.

What are the optimal analytical methods for studying P. stutzeri Protease HtpX interactions with potential inhibitors?

When investigating interactions between P. stutzeri Protease HtpX and potential inhibitors, a multi-faceted analytical approach yields the most comprehensive results:

  • In silico screening and molecular dynamics:

    • Composite high-throughput virtual screening against structural models of HtpX can identify candidate inhibitors

    • Molecular dynamics simulations can predict binding energies and conformational changes upon inhibitor binding

    • Computational methods like CASTpFold can identify and characterize binding pockets for targeted inhibitor design

  • Binding affinity determination:

    • Fluorescence quenching experiments can quantify binding constants (Kd)

    • For example, with NgHtpX metal-binding domain, pemirolast binding (Kd = 3.47 μM) and thalidomide binding (Kd = 1.04 μM) were determined using this approach

    • Isothermal titration calorimetry (ITC) provides comprehensive thermodynamic parameters of binding

    • Surface plasmon resonance (SPR) allows real-time analysis of binding kinetics

  • Structural characterization of inhibitor complexes:

    • X-ray crystallography of HtpX-inhibitor complexes provides atomic-level details of binding modes

    • NMR spectroscopy can identify specific residues involved in inhibitor interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes upon inhibitor binding

  • Functional inhibition assays:

    • Enzymatic activity assays using fluorogenic substrates can quantify inhibition potency (IC50 values)

    • Dose-response curves should be generated to establish inhibition profiles

    • All experiments should be conducted in triplicate with appropriate statistical analysis

  • Cellular validation:

    • Culture-based viability assays can assess the biological effect of inhibitors

    • Dose-dependent reduction in bacterial viability provides functional validation of target engagement

    • Growth curve analysis and minimum inhibitory concentration (MIC) determination quantify antimicrobial effects

  • Specificity profiling:

    • Counter-screening against related metalloproteases assesses inhibitor selectivity

    • Testing against mammalian metalloproteases evaluates potential off-target effects

    • Activity-based protein profiling can identify additional cellular targets

A comprehensive approach utilizing these analytical methods provides robust characterization of inhibitor interactions, facilitating the development of potent and selective HtpX inhibitors with potential antimicrobial applications.

What are common challenges in recombinant P. stutzeri Protease HtpX expression and how can they be addressed?

Recombinant expression of P. stutzeri Protease HtpX presents several technical challenges that researchers commonly encounter. These issues and their suggested solutions include:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Try different expression vectors with varied promoter strengths

    • Consider fusion partners that enhance solubility (MBP, SUMO, etc.)

    • Screen multiple expression conditions (temperature, induction time, inducer concentration)

    • The documented 61.9-fold increase in fermentation level with engineering strain WB800N/pHT43-htpX demonstrates the impact of optimized expression systems

  • Protein insolubility:

    • As a transmembrane protein, HtpX may form inclusion bodies

    • Lower expression temperature (16-25°C) can improve folding

    • Add solubilizing agents like arginine or detergents to expression media

    • Consider refolding protocols if expression in inclusion bodies is unavoidable

    • Test different detergents for extraction (DDM, LDAO, Triton X-100)

  • Loss of metal cofactors:

    • Supplement growth media with appropriate metal ions (Zn²⁺, Ca²⁺)

    • Include metal ions in all purification buffers

    • Avoid strong chelating agents during purification

    • Consider metal reconstitution steps post-purification

  • Proteolytic degradation:

    • Include protease inhibitors in all buffers

    • Minimize processing time and maintain cold temperatures

    • Consider using protease-deficient expression strains

    • Engineer constructs to remove exposed protease-sensitive regions

  • Loss of activity during storage:

    • Follow recommended storage conditions (-20°C/-80°C)

    • Add glycerol (5-50%) to prevent freezing damage

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

  • Verification of successful expression:

    • Employ SDS-PAGE analysis to confirm expression

    • Western blotting with anti-His antibodies for tagged constructs

    • Enzymatic activity assays to verify functional expression

    • Mass spectrometry to confirm protein identity

By systematically addressing these challenges through the suggested optimization strategies, researchers can significantly improve the yield and quality of recombinant P. stutzeri Protease HtpX for downstream applications.

What emerging research areas could benefit from further study of P. stutzeri Protease HtpX?

Several promising research directions could significantly advance our understanding of P. stutzeri Protease HtpX and expand its applications:

  • Antimicrobial resistance strategies:

    • HtpX conservation across drug-resistant and susceptible bacterial isolates positions it as a potential target for novel antimicrobials

    • Further investigation into the role of HtpX in stress response and whether it contributes to bacterial resilience under antibiotic pressure

    • Development of HtpX inhibitors as adjunctive therapy to existing antibiotics to potentially overcome resistance mechanisms

  • Structure-function relationship studies:

    • High-resolution structural determination of P. stutzeri HtpX through X-ray crystallography or cryo-EM

    • Detailed mapping of substrate binding sites and specificity determinants

    • Investigation of the role of metal ions in structural stability and catalytic function

    • Comparative analysis with HtpX from other bacterial species to identify conserved functional elements

  • Physiological role elucidation:

    • Comprehensive identification of natural substrates through proteomics approaches

    • Investigation of HtpX's role in bacterial stress response pathways

    • Study of potential contributions to virulence and host-pathogen interactions

    • Systems biology approaches to position HtpX within bacterial protein quality control networks

  • Biotechnological applications:

    • Exploration of HtpX as a biocatalyst for industrial applications

    • Engineering HtpX variants with enhanced stability or altered specificity

    • Development of biosensors based on HtpX activity or inhibition

    • The 61.9-fold increase in fermentation level observed with engineered HtpX suggests potential for biotechnological optimization

  • Diagnostic tool development:

    • Investigation of HtpX as a potential biomarker for Pseudomonas infections

    • Development of activity-based probes targeting HtpX for bacterial detection

    • Exploration of HtpX-specific antibodies for diagnostic applications

  • Comparative proteomics:

    • Expanding on the combined bottom-up and top-down proteomics approaches that have already identified 2950 proteins in P. stutzeri

    • Integration of proteogenomic pipelines to identify novel proteoforms and potential interactions with HtpX

    • Investigation of post-translational modifications that might regulate HtpX activity in vivo

These research directions represent significant opportunities to advance our understanding of P. stutzeri Protease HtpX and potentially develop novel applications in antimicrobial therapy, diagnostics, and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.