Recombinant Pseudomonas stutzeri Putative phosphite transport system permease protein htxC (htxC)

Shipped with Ice Packs
In Stock

Description

Biological Role and Genetic Context

HtxC is a permease component of the putative phosphite transport system encoded by the htxABCDEFGHIJKLMN operon in P. stutzeri WM88. This operon includes:

  • HtxA: A hypophosphite-2-oxoglutarate dioxygenase responsible for oxidizing hypophosphite to phosphite .

  • HtxB–HtxN: Homologs of Escherichia coli C–P lyase components, involved in cleaving carbon–phosphorus bonds .

  • HtxC: A transmembrane permease hypothesized to facilitate phosphite transport across the cell membrane .

The htx operon is transcriptionally regulated by phosphate starvation via the PhoBR two-component system, with expression induced up to 17-fold under low-phosphate conditions .

Recombinant Protein Production

HtxC has been recombinantly expressed in E. coli and Saccharomyces cerevisiae systems for biochemical studies. Key specifications include:

Table 1: Recombinant HtxC Variants

PropertyDetailsSource
HostE. coli or S. cerevisiae
TagN-terminal His tag
Protein LengthFull-length (1–282 amino acids) or partial sequences
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C
ReconstitutionRequires sterile water; glycerol (5–50%) recommended for long-term storage

Biochemical Characteristics

  • Sequence: The full-length HtxC protein (UniProt ID: O69062) has 282 residues, including conserved domains for membrane localization and substrate binding .

  • Function: As a permease, HtxC likely partners with HtxA and HtxB to form a binding protein-dependent transporter for phosphite uptake .

  • Interactions: Genetic evidence suggests cooperation with the ptxABCDE operon (phosphite dehydrogenase system) and phn operons (C–P lyase pathways) .

Research Applications

  • Phosphorus Metabolism Studies: Used to investigate bacterial adaptation to phosphate scarcity via alternative P sources .

  • Enzyme Kinetics: Recombinant HtxC aids in characterizing transport kinetics and substrate specificity of phosphite uptake .

  • Genetic Engineering: Serves as a model for engineering phosphorus utilization pathways in bioremediation or agricultural microbes .

Key Research Findings

  • Dual C–P Lyase Systems: P. stutzeri possesses two functional C–P lyase operons (htx and phn), with HtxC contributing to phosphite oxidation independently of the PtxD pathway .

  • Regulatory Insights: The htx operon’s induction under phosphate starvation highlights its role in phosphorus scavenging, though environmental phosphite levels remain unquantified .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
htxC; Putative phosphite transport system permease protein HtxC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Pseudomonas stutzeri (Pseudomonas perfectomarina)
Target Names
htxC
Target Protein Sequence
MNQRIEEVMLANVKRDVARRKRHFATSVVVLSLLAVAWYVCQIEFQKLGAGLPRLWSFVV QMFPPDLSDLDVILKGAGETLAMATIGTIFATIIAFPLALMAARNTCPNKWTYRVSRAIL NASRGTETFVYALVFVAAVGFGPFSGVLAITFHMVGAIGKMFAEAIEPVDQGPLDALALT GASRAKIIRYGLIPDVMPHLIASVLYIWEFSVRTSTVLGIVGAGGIGQTLKDTVDLLEFN KMITVLAVVLLMVSAIDFISDRLRYLILDTKREGFETLPANN
Uniprot No.

Target Background

Function
Likely plays a role in a binding-protein-dependent hypophosphite transporter system.
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does htxC relate to the broader phosphorus metabolism pathways in P. stutzeri?

htxC functions within a complex network of phosphorus metabolism in P. stutzeri. The htx operon works in conjunction with the ptx operon to enable the utilization of reduced phosphorus compounds. While the htx operon is primarily associated with hypophosphite metabolism (P valence, +1), evidence suggests it may also have roles in phosphite (P valence, +3) metabolism.

The relationship between these systems is hierarchical and regulated by environmental phosphate availability. Expression studies demonstrate that both htx and ptx operons are significantly induced (up to 17-fold and 22-fold, respectively) under phosphate starvation conditions. This suggests that these alternative phosphorus assimilation pathways represent adaptive mechanisms for P. stutzeri to survive in phosphate-limited environments .

What are the optimal conditions for expression and purification of recombinant htxC protein?

The optimal expression and purification of recombinant htxC typically involves:

Expression System:

  • Host: E. coli expression system

  • Vector: pET or similar with N-terminal His-tag

  • Induction: IPTG (0.5-1.0 mM) at mid-log phase

  • Temperature: 18-25°C post-induction for 16-20 hours (lower temperatures often improve membrane protein folding)

Purification Protocol:

  • Cell lysis via sonication or pressure homogenization in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM PMSF

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization with mild detergents (DDM, LDAO, or C12E8 at 1%)

  • Affinity chromatography using Ni-NTA resin

  • Size exclusion chromatography for final purification

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

How can researchers effectively study the transport activity of htxC in vitro?

Studying htxC transport activity requires reconstitution into a membrane system that mimics its native environment. A methodological approach includes:

Liposome Reconstitution Method:

  • Prepare phospholipid vesicles (typically E. coli polar lipid extract with POPC at 3:1 ratio)

  • Solubilize lipids with appropriate detergent

  • Add purified htxC protein (protein:lipid ratio of 1:100 to 1:200)

  • Remove detergent via Bio-Beads or dialysis

  • Verify reconstitution via freeze-fracture electron microscopy

Transport Assay Approaches:

  • Radioactive substrate uptake: Use 32P-labeled phosphite

  • Fluorescence-based assays: Employ pH-sensitive fluorophores to detect proton cotransport

  • Counterflow assays: Measure exchange of internal versus external substrate

  • Patch-clamp electrophysiology: For electrogenic transport measurement

Critical Controls:

  • Proteoliposomes without protein

  • Competitive inhibition with excess unlabeled substrate

  • Gradient manipulation (pH, membrane potential)

Data analysis should employ robust statistical methods such as trimmed-mean polish preprocessing to remove plate, row, and column biases, followed by formal statistical tests like the RVM t-test to distinguish genuine transport activity from background fluctuations .

How does the genetic organization of the htx operon influence htxC expression and function?

The genetic organization of the htx operon directly impacts htxC expression and function through:

Operon Structure and Regulation:
The htxABCDEFGHIJKLMN operon is organized as a single transcriptional unit, with genes cotranscribed based on intergenic sequences verified by reverse transcription-PCR with total RNA. The operon is primarily regulated by phosphate availability through phosphate response regulators .

Key Regulatory Features:

  • Phosphate starvation induces expression up to 17-fold

  • No induction occurs in the presence of excess phosphate even when hypophosphite, phosphite, or methylphosphonate are present

  • The expression is likely controlled by a PhoBR-like two-component system responding to phosphate limitation

Functional Implications:
The position of htxC in the operon suggests it functions as part of a coordinated phosphite/hypophosphite transport and metabolism system. Specifically, htxC encodes a permease component that works with other proteins in the operon:

  • HtxB likely functions as a periplasmic binding protein

  • HtxD likely functions as an ATP-binding component

  • Together forming a complete ABC-type transport system

Mutations in upstream genes can create polar effects on htxC expression due to this operon structure, which researchers must consider when designing genetic studies .

What approaches are most effective for generating and characterizing htxC mutants?

Generating and characterizing htxC mutants requires specialized approaches due to its membrane protein nature and operon context:

Mutation Generation Strategies:

  • Targeted gene replacement:

    • Creating a deletion construct with antibiotic resistance marker flanked by homologous regions

    • Double homologous recombination followed by sacB counterselection

    • Example methodology: Using suicide vectors like pAW30 or pAW41 introduced via conjugation into P. stutzeri WM567

  • Site-directed mutagenesis:

    • Targeting conserved residues in transmembrane domains or cytoplasmic loops

    • Focusing on putative substrate binding sites or conformational change regions

    • Creating alanine scanning libraries of conserved motifs

Characterization Approaches:

  • Growth phenotype analysis:

    • Comparative growth curves in media with different P sources

    • Minimum inhibitory concentration determination for toxic phosphonates

    • Competition assays with wild-type under phosphate limitation

  • Reporter gene fusions:

    • Construction of htxC::lacZ translational fusions

    • Measurement of expression under various phosphorus conditions

    • Analysis of regulatory interactions with other phosphorus assimilation systems

  • Protein localization and interaction studies:

    • Fluorescent protein fusions for localization

    • Bacterial two-hybrid assays for protein-protein interactions

    • Crosslinking studies to identify interaction partners

  • Transport activity measurements:

    • Radioactive substrate uptake assays

    • Comparison between wild-type, mutant, and complemented strains

Proper verification of mutations requires DNA hybridization analysis or sequencing to confirm the precise genetic alterations .

How does htxC compare to similar transport proteins in other bacterial species?

htxC shows significant structural and functional homology to components of phosphorus transport systems across bacterial species, providing insights into its evolutionary history:

Comparative Analysis Table:

OrganismProteinIdentity/Similarity to htxCFunctionKey Differences
E. coliPhnC~30-35% identityPhosphonate transportPart of C-P lyase pathway
E. coliPitA~25-30% identityPhosphate transportLow-affinity Pi transporter
P. fluorescensPtxC~60-65% identityPhosphite transportSpecialized for phosphite
Rhodopseudomonas palustrisPtxB~40-45% identityPhosphite transportDifferent regulatory control

Structural Comparison:
htxC contains predicted transmembrane domains that align with other bacterial ABC transporter permease components. Key conserved motifs include:

  • The EAA loop (residues ~180-200) that interfaces with the ATP-binding protein

  • Hydrophobic transmembrane segments with conserved residues likely involved in substrate recognition

  • Cytoplasmic loops containing charged residues that may participate in conformational changes during transport

Functional Conservation:
Despite sequence divergence, the core function of phosphorus-containing compound transport is preserved across these proteins, suggesting strong selective pressure for maintaining phosphorus acquisition mechanisms in bacteria .

What is the evolutionary significance of the htx operon in bacterial phosphorus metabolism?

The evolutionary significance of the htx operon reveals sophisticated adaptive strategies for phosphorus acquisition:

Evolutionary Context:
The htx operon appears to have evolved as part of a specialized strategy for utilizing reduced phosphorus compounds in environments where orthophosphate is limited. Phylogenetic analysis suggests that the htx genes share ancestry with the phn operon of E. coli but have diverged to specialize in hypophosphite/phosphite metabolism rather than phosphonate degradation.

Selective Advantages:

  • Provides access to alternative phosphorus sources in oligotrophic environments

  • May confer competitive advantage in specific ecological niches where reduced phosphorus compounds are available

  • Demonstrates the modularity of bacterial transport systems, with components recruited and repurposed through evolution

Operon Evolution:
The htx operon lacks homologs of E. coli phnF and phnO, suggesting selective loss or gain of regulatory components. Additionally, the presence of multiple C-P lyase operons in P. stutzeri (both htx and a second unidentified system) indicates potential gene duplication events followed by functional divergence.

The inducibility of the htx operon specifically under phosphate starvation conditions, rather than by substrate presence, suggests its primary role as a "hunger response" mechanism rather than a specialized metabolic pathway for these compounds as primary nutrient sources .

How can structural biology approaches be applied to characterize htxC transport mechanisms?

Advanced structural biology techniques provide crucial insights into htxC transport mechanisms:

Cryo-Electron Microscopy (Cryo-EM):

  • Sample preparation using purified htxC in nanodiscs or amphipols

  • Single-particle analysis to determine 3D structure at near-atomic resolution

  • Visualization of different conformational states with and without substrate

X-ray Crystallography:

  • Crystallization trials using vapor diffusion methods with detergent-solubilized htxC

  • Use of lipidic cubic phase (LCP) for membrane protein crystallization

  • Structure determination and refinement to identify substrate binding sites

Molecular Dynamics Simulations:

  • Construction of htxC models in phospholipid bilayers

  • Simulation of phosphite binding and conformational changes

  • Identification of water molecules and protons involved in the transport process

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Mapping regions of conformational flexibility during transport cycle

  • Comparison of deuterium uptake patterns in various liganded states

  • Identification of allosteric communication networks within the protein

These complementary approaches can reveal the structural basis for substrate specificity, transport coupling, and regulatory mechanisms. Researchers should focus on capturing structures in different conformational states to elucidate the complete transport cycle .

What are the current challenges and controversies in understanding htxC function?

Several significant challenges and controversies persist in htxC research:

Substrate Specificity Uncertainties:
Despite its annotation as a phosphite transport system component, there remains debate about whether htxC can transport other phosphorus compounds. The relationship between the htx and ptx operons suggests potential redundancy or complementarity in substrate recognition that requires clarification through rigorous biochemical studies.

Mechanistic Questions:

  • Is transport coupled to ATP hydrolysis, proton gradient, or both?

  • What is the stoichiometry of transport (substrate:proton ratio)?

  • How is substrate specificity determined at the molecular level?

Regulatory Complexity: The observation that the htx operon is induced by phosphate limitation but not by the presence of its putative substrates raises questions about the evolutionary purpose of this system. Does it function primarily as a scavenging system for rare phosphorus sources, or does it serve other physiological roles?

Methodological Challenges:
Membrane protein research involves inherent difficulties in expression, purification, and functional reconstitution. Current assays may not fully recapitulate the native environment, leading to potential artifacts or incomplete understanding of transport kinetics and regulation .

What quality control measures are essential when working with recombinant htxC protein?

Rigorous quality control is critical for reliable htxC research:

Expression and Purification Quality Control:

  • Purity assessment: SDS-PAGE with Coomassie staining (>90% purity required)

  • Identity confirmation: Western blotting with anti-His antibodies and mass spectrometry

  • Homogeneity evaluation: Size exclusion chromatography profiles

  • Aggregation detection: Dynamic light scattering

  • Secondary structure verification: Circular dichroism spectroscopy

Functional Quality Control:

  • Binding assays: Isothermal titration calorimetry with phosphite

  • ATPase coupled assays: When reconstituted with ATP-binding components

  • Reconstitution efficiency: Freeze-fracture electron microscopy of proteoliposomes

  • Orientation determination: Protease protection assays

Storage and Stability Monitoring:

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C/-80°C with 5-50% glycerol

  • Periodically verify protein integrity by SDS-PAGE

Documentation Requirements:
Maintain detailed records of expression conditions, purification methods, and batch-to-batch variation for reproducibility. When handling recombinant htxC, verify proper reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with appropriate glycerol concentration (recommended final concentration of 50%) .

How can researchers optimize experimental design when studying htxC in different bacterial systems?

Optimizing experimental design for htxC studies requires careful consideration of several factors:

Expression System Selection:

  • Homologous expression: Using modified P. stutzeri strains

    • Advantages: Native folding environment, appropriate post-translational modifications

    • Disadvantages: Lower yields, more challenging genetic manipulation

  • Heterologous expression: Using E. coli

    • Advantages: Higher yields, established protocols, easier genetic manipulation

    • Disadvantages: Potential folding issues, improper membrane insertion

Statistical Design Considerations:

  • Include adequate biological and technical replicates (minimum n=3)

  • Employ randomized block designs to control for batch effects

  • Use robust data preprocessing methods to remove row, column, and plate biases

  • Apply formal statistical models like RVM t-tests for hit identification

  • Conduct ROC analyses to optimize true-positive rates without increasing false-positives

Control Selection:

  • Positive controls: Well-characterized membrane transporters (e.g., LacY)

  • Negative controls: Inactive mutants with point mutations in critical residues

  • System controls: Empty vectors, host strains without recombinant protein

Validation Strategies:

  • Cross-validate key findings with complementary techniques

  • Confirm protein expression and localization via fluorescent tagging

  • Verify transport activity using multiple independent assays

  • Employ genetic complementation to confirm phenotype-genotype relationships

By implementing these design principles, researchers can enhance data reliability, minimize artifacts, and generate more reproducible results in htxC studies across different bacterial systems .

What emerging technologies might advance our understanding of htxC and related transport systems?

Several cutting-edge technologies offer promising avenues for htxC research:

Single-Molecule Techniques:

  • FRET-based approaches for real-time monitoring of conformational changes

  • Single-molecule force spectroscopy to measure substrate binding energetics

  • Total internal reflection fluorescence (TIRF) microscopy to observe transport events at the single-molecule level

Advanced Imaging:

  • Super-resolution microscopy (PALM/STORM) for visualizing htxC distribution and dynamics in bacterial membranes

  • Correlative light and electron microscopy (CLEM) to link cellular localization with ultrastructural context

  • Cryo-electron tomography for in situ structural analysis in the native membrane environment

Genomic and Systems Biology Approaches:

  • CRISPR-Cas9 base editing for precise mutational analysis

  • Ribosome profiling to measure translation efficiency of htxC under different conditions

  • Metabolomics to determine global impacts of htxC mutations on phosphorus metabolism

Computational Methods:

  • Deep learning approaches for predicting substrate-protein interactions

  • Coarse-grained molecular dynamics for long-timescale simulations of transport cycles

  • Evolutionary coupling analysis to identify co-evolving residues critical for function

These technologies, when integrated with traditional biochemical and genetic approaches, will provide unprecedented insights into the molecular mechanisms, regulation, and physiological roles of htxC in bacterial phosphorus metabolism .

How might understanding htxC function contribute to broader biotechnological applications?

Insights from htxC research have significant potential for diverse biotechnological applications:

Bioremediation Applications:

  • Engineering bacteria with enhanced phosphite/hypophosphite uptake for phosphorus recovery from contaminated soils and waters

  • Development of biosensors for monitoring reduced phosphorus compounds in environmental samples

  • Creating bacterial strains that can convert toxic phosphorus compounds into bioavailable forms

Agricultural Innovations:

  • Designing plant-associated bacteria that can mobilize soil phosphorus reserves for improved crop nutrition

  • Engineering rhizosphere microbes with modified htxC for enhanced phosphorus solubilization and uptake

  • Developing microbial inoculants that reduce phosphate fertilizer requirements

Synthetic Biology Tools:

  • Using htxC as a modular component in engineered phosphorus sensing and acquisition systems

  • Creating inducible expression systems regulated by phosphite as an orthogonal input signal

  • Designing artificial transporters with novel substrate specificities based on htxC structure

Biomedical Relevance:

  • Understanding bacterial phosphorus transport as a potential target for new antimicrobial strategies

  • Exploring htxC homologs in pathogenic bacteria as virulence factors during phosphate-limited infection conditions

  • Studying the role of phosphorus transport in bacterial persistence and antibiotic tolerance

These applications highlight the translational potential of fundamental research on bacterial phosphorus transport systems like htxC, bridging basic science with practical solutions to environmental, agricultural, and medical challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.