Recombinant Pseudomonas stutzeri Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Description

Role in Cell Wall Biosynthesis

uppP1 recycles UP, enabling the regeneration of lipid carriers for peptidoglycan assembly. This activity directly impacts bacterial resistance to bacitracin, which targets UPP .

Oxidative Stress Resistance

Studies on P. stutzeri A1501 reveal that uppP1 operates within a regulatory network involving the ncRNA NfiS and catalase KatB. This system enhances oxidative stress resistance and nitrogenase activity under H<sub>2</sub>O<sub>2</sub> exposure .

Metabolic Engineering Applications

Deletion of genes in L-leucine degradation pathways (e.g., pst_3217) improves acetate utilization in P. stutzeri strains, enabling poly-3-hydroxybutyrate (PHB) production. Recombinant strains expressing uppP1 show enhanced metabolic flexibility under stress .

Key Experimental Data

  • PHB Yield: Recombinant P. stutzeripst_3217) with heterologous phbCAB genes produced 0.11 g/L PHB from acetate, representing 12% of dry cell weight .

  • Catalytic Efficiency: uppP1’s activity is optimal at pH 7–8 and temperatures of 25–37°C, with a turnover number (k<sub>cat</sub>) of 4.2 × 10<sup>3</sup> min<sup>-1</sup> .

Comparative Genomics

Orthologs of uppP1 are conserved across 569 bacterial genera, including Pseudomonas entomophila (UniProt Q1I9H0) . Structural predictions using DeepMind’s AlphaFold confirm transmembrane helices critical for substrate binding .

Biotechnological Relevance

ApplicationDetails
Antibiotic ResearchTarget for overcoming bacitracin resistance in Gram-negative pathogens .
Biofuel ProductionEngineered strains utilize acetate for PHB synthesis, aligning with carbon-neutral goals .
Stress Response StudiesUsed to dissect oxidative stress pathways in nitrogen-fixing bacteria .

Future Directions

Recent proteomic studies identified 29 novel small proteins in P. stutzeri, suggesting unexplored regulatory interactions with uppP1 . Further work could optimize its activity for industrial biocatalysis or antimicrobial development.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP1; PST_2210; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
uppP1
Target Protein Sequence
MDLWVAIQALILGVVEGITEFLPVSSTGHQIIVADLIGFGGERALAFNIIIQLGAILAVI WEYRRKIIDVVVGLPEERQAQKFTVNLLIAFMPAVVLGVAFADLIHEYLFNPITVAAALV IGGIVMLWAERRDHAIRAETVDDMTWTLALKVGFAQCLALVPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRDLFQPGDFAVFAIGFVTSFIFAMLAVRALLKF IGNHSYAAFAWYRIGFGLLILATWQLGMIDWSTAIG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should recombinant uppP1 be stored and handled in laboratory settings?

Proper storage and handling of recombinant uppP1 is essential for maintaining enzymatic activity. The protein should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized for protein stability. For short-term storage (up to one week), working aliquots can be kept at 4°C. For longer-term storage, the protein should be kept at -20°C, and for extended storage periods, -80°C is recommended. Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

When working with the protein, it's advisable to:

  • Thaw aliquots on ice

  • Use sterile pipette tips and tubes

  • Centrifuge briefly before opening to collect any protein that may have adhered to the cap

  • Prepare working dilutions immediately before use

Storage DurationRecommended TemperatureNotes
Up to 1 week4°CWorking aliquots only
Up to 6 months-20°CIn 50% glycerol buffer
> 6 months-80°CAvoid repeated freeze-thaw

What expression systems are commonly used for producing recombinant P. stutzeri uppP1?

The production of recombinant P. stutzeri uppP1 typically involves heterologous expression systems. Based on general recombinant protein methodologies and the specific characteristics of membrane proteins like uppP1, the following expression systems are commonly employed:

Bacterial Expression Systems:
E. coli is frequently used for the expression of P. stutzeri proteins, including uppP1. For membrane proteins like uppP1, specialized E. coli strains such as C41(DE3) or C43(DE3) may provide better results as they are designed to accommodate potentially toxic membrane proteins. The expression can be controlled using inducible promoters, such as the T7 promoter in conjunction with IPTG induction .

For genetic manipulation of P. stutzeri itself, the pK18 mobsacB system has been documented as an effective method. This approach allows for gene deletion, modification, or overexpression directly in P. stutzeri strains through homologous recombination techniques .

What methodological approaches are recommended for studying uppP1 enzymatic activity?

The enzymatic activity of uppP1 (Undecaprenyl-diphosphatase) can be assessed using several methodological approaches:

Radiometric Assays:
A common method involves using radiolabeled substrates such as [14C]-undecaprenyl pyrophosphate. The reaction products can be separated by thin-layer chromatography (TLC) and quantified by liquid scintillation counting. This approach provides high sensitivity but requires specialized equipment and handling of radioactive materials.

Colorimetric Assays:
The release of inorganic phosphate during the dephosphorylation reaction can be measured using colorimetric detection methods such as the malachite green assay. This approach offers:

  • Simpler setup compared to radiometric methods

  • No radioactive waste

  • Potential for high-throughput screening

  • Lower sensitivity than radiometric methods

Coupled Enzyme Assays:
The phosphate released by uppP1 activity can be coupled to other enzymatic reactions that produce a detectable signal:

Undecaprenyl-PPuppP1Undecaprenyl-P+Pi\text{Undecaprenyl-PP} \xrightarrow{\text{uppP1}} \text{Undecaprenyl-P} + \text{P}_i Pi+substratecoupling enzymeproduct (detectable)\text{P}_i + \text{substrate} \xrightarrow{\text{coupling enzyme}} \text{product (detectable)}

When designing uppP1 activity assays, researchers should consider:

  • The membrane-associated nature of the enzyme

  • The need for appropriate detergents to maintain solubility

  • The potential impact of buffer components on enzymatic activity

  • Temperature and pH optimization

How can genetic modification techniques be applied to study uppP1 function in P. stutzeri?

Genetic modification techniques provide powerful tools for studying uppP1 function in P. stutzeri. The pK18 mobsacB system has been established as an effective method for gene manipulation in this organism. The following methodology can be applied specifically to uppP1 studies:

Gene Deletion Approach:

  • Amplify homologous arms upstream and downstream of the uppP1 gene using PCR with specific primers

  • Fuse these fragments via recombinant PCR

  • Clone the fusion fragments into the pK18 mobsacB vector using restriction enzymes (e.g., EcoRI and BamHI) or the TEDA (T5 exonuclease DNA assembly) method

  • Transfer the constructed plasmid into P. stutzeri via tri-parental mating with helper E. coli strains carrying pRK2013

  • Select single-crossover mutants on appropriate selective media

  • Screen for double-crossover events using sucrose selection (20% w/v)

This approach allows for the creation of clean deletions without leaving antibiotic resistance markers in the genome.

Complementation and Overexpression Studies:
For functional analysis, the uppP1 gene can be cloned into expression vectors such as pBBR1MCS-2. This approach allows for:

  • Complementation of uppP1 deletion mutants

  • Overexpression studies to assess the effect of increased uppP1 levels

  • Expression of modified versions of uppP1 (e.g., site-directed mutants)

The transfer of expression plasmids into P. stutzeri can be achieved through electroporation, providing a straightforward method for genetic manipulation .

How does P. stutzeri uppP1 compare to homologous proteins in other bacterial species?

Undecaprenyl-diphosphatase enzymes are widely distributed across bacterial species, with varying degrees of sequence and functional conservation. Comparative analysis reveals important insights:

Functional Diversity:
While the core catalytic function (dephosphorylation of undecaprenyl pyrophosphate) is conserved, there are notable differences in:

  • Substrate specificity

  • Kinetic parameters

  • Regulatory mechanisms

  • Antibiotic resistance profiles

Evolutionary Significance:
As a bacitracin resistance protein, uppP1 represents an important component of the antimicrobial resistance machinery in P. stutzeri. Comparative analysis with homologs from other species can provide insights into the evolution of antibiotic resistance mechanisms.

The gene context of uppP1 (PST_2210) in P. stutzeri provides additional information about its functional relationships with other components of cell wall biosynthesis and regulation pathways .

How can recombinant P. stutzeri uppP1 be incorporated into ELISA-based detection systems?

Recombinant P. stutzeri uppP1 can be effectively incorporated into ELISA (Enzyme-Linked Immunosorbent Assay) systems for various research applications. The methodological approach includes:

Direct ELISA Protocol:

  • Coat microplate wells with purified recombinant uppP1 protein (typically 1-10 μg/mL in carbonate-bicarbonate buffer, pH 9.6)

  • Block non-specific binding sites with BSA or non-fat dry milk

  • Incubate with primary antibodies (either commercial anti-uppP1 or patient sera for immunological studies)

  • Add enzyme-conjugated secondary antibodies

  • Develop with appropriate substrate and measure absorbance

Sandwich ELISA Protocol:
For higher specificity, particularly when working with complex samples:

  • Coat wells with capture antibodies specific to uppP1

  • Add samples containing target protein

  • Detect bound uppP1 with a different epitope-binding detection antibody

  • Complete with enzyme-conjugated secondary antibody and substrate

The recombinant protein preparation (50 μg quantity in Tris-based buffer with 50% glycerol) is suitable for these applications when appropriately diluted .

What role does uppP1 play in bacterial antibiotic resistance mechanisms?

Undecaprenyl-diphosphatase 1 (uppP1) plays a significant role in bacterial antibiotic resistance, particularly against antimicrobials that target cell wall biosynthesis:

Bacitracin Resistance:
The alternative name "Bacitracin resistance protein 1" highlights uppP1's importance in protection against this specific antibiotic. Bacitracin acts by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and recycling. By rapidly dephosphorylating undecaprenyl pyrophosphate, uppP1 reduces the available target for bacitracin, thereby conferring resistance .

Resistance Mechanism:
The biochemical pathway can be represented as:

Undecaprenyl-PP+H2OuppP1Undecaprenyl-P+Pi\text{Undecaprenyl-PP} + \text{H}_2\text{O} \xrightarrow{\text{uppP1}} \text{Undecaprenyl-P} + \text{P}_i

When uppP1 is overexpressed or has enhanced activity, this reaction occurs more rapidly, reducing the pool of undecaprenyl pyrophosphate available for bacitracin binding.

Clinical Significance:
Understanding the mechanism and regulation of uppP1 activity contributes to:

  • Development of new strategies to combat antimicrobial resistance

  • Identification of potential inhibitors that could restore sensitivity to bacitracin and related antibiotics

  • Better prediction of resistance development in clinical settings

What are the optimal conditions for measuring uppP1 enzymatic activity in vitro?

The optimization of assay conditions is critical for accurate measurement of uppP1 enzymatic activity. The following parameters should be considered:

Buffer Composition:

  • pH range: Typically 7.0-8.0 (phosphate or Tris-based buffers)

  • Ionic strength: 50-200 mM NaCl or KCl

  • Divalent cations: Mg²⁺ (1-5 mM) is often required as a cofactor

  • Reducing agents: DTT or β-mercaptoethanol (1-5 mM) to maintain cysteine residues in reduced state

Detergent Selection:
As a membrane protein, uppP1 requires detergents for solubilization while maintaining activity:

  • Mild detergents like n-dodecyl-β-D-maltoside (DDM) at 0.01-0.05%

  • Alternatives include CHAPS, Triton X-100, or digitonin

  • Detergent concentration should be above CMC but not high enough to denature the protein

Temperature and Time:

  • Temperature range: 25-37°C is typical for most bacterial enzymes

  • Reaction time: Linear phase of product formation (typically 5-30 minutes)

Substrate Considerations:

  • Concentration range: 0.1-10× Km (determined experimentally)

  • Preparation: Solubilized in appropriate detergent

  • Storage: Protected from light and oxidation

A typical reaction mixture might include:

  • 50 mM Tris-HCl, pH 7.5

  • 100 mM NaCl

  • 5 mM MgCl₂

  • 1 mM DTT

  • 0.02% DDM

  • 50-200 μM undecaprenyl pyrophosphate substrate

  • 0.1-1 μg purified recombinant uppP1

How can genetic modifications enhance the study of P. stutzeri uppP1 in biotechnological applications?

Genetic modification approaches offer powerful tools for enhancing P. stutzeri uppP1 studies and applications:

Site-Directed Mutagenesis:
Targeted mutations can be introduced to:

  • Alter catalytic efficiency

  • Modify substrate specificity

  • Enhance stability

  • Create tagged versions for purification and detection

Chromosomal Integration:
Using the pK18 mobsacB system, modified versions of uppP1 can be integrated into the P. stutzeri chromosome:

  • Design homologous arms for the target locus

  • Create fusion PCR products containing the modified uppP1

  • Clone into pK18 mobsacB vector

  • Introduce into P. stutzeri via tri-parental mating

  • Select for double crossover events using sucrose selection

Expression Optimization:
For biotechnological applications requiring high protein yields:

  • Codon optimization for the expression host

  • Promoter selection (constitutive vs. inducible)

  • Signal sequence modification for proper membrane targeting

  • Co-expression with chaperones to enhance folding

Reporter Fusions:
Fusion constructs with reporter proteins (GFP, luciferase) can provide insights into:

  • Protein localization

  • Expression levels

  • Protein-protein interactions

  • Real-time activity monitoring

The genetic modification approaches used for P. stutzeri, such as those employed in the development of the PHB-producing strain (P. stutzeri Δpst_3217-phbCAB), demonstrate the feasibility of complex genetic engineering in this species .

How might uppP1 research contribute to novel antimicrobial development strategies?

Research on Pseudomonas stutzeri uppP1 presents significant opportunities for antimicrobial development:

Target-Based Drug Design:
As a crucial enzyme in cell wall biosynthesis, uppP1 represents a promising target for novel antimicrobials. Understanding its structure and catalytic mechanism facilitates:

  • Structure-based virtual screening for potential inhibitors

  • Fragment-based drug design approaches

  • Rational modification of known inhibitors to enhance specificity and potency

Resistance Mechanism Insights:
By elucidating how uppP1 contributes to bacitracin resistance, researchers can develop strategies to overcome this resistance mechanism:

  • Combination therapies that target both uppP1 and other components of the cell wall synthesis pathway

  • Development of modified bacitracin derivatives that maintain efficacy against resistant strains

  • Identification of collateral sensitivities that emerge when uppP1 is overexpressed

Comparative Studies across Pathogens:
Analysis of uppP1 homologs across different bacterial pathogens can identify:

  • Conserved features that could serve as broad-spectrum targets

  • Species-specific characteristics that might enable selective targeting

  • Evolutionary patterns that predict resistance development

The potential impact of uppP1 research extends beyond Pseudomonas species to address broader challenges in antimicrobial resistance, which remains one of the most pressing public health concerns globally .

What computational approaches are valuable for studying uppP1 structure and function?

Modern computational methods provide powerful tools for investigating uppP1 structure and function:

Homology Modeling:
In the absence of a crystal structure for P. stutzeri uppP1, homology modeling based on related proteins can predict:

Molecular Dynamics Simulations:
MD simulations in membrane environments can reveal:

  • Conformational flexibility and dynamics

  • Membrane interaction profiles

  • Water and ion accessibility to the active site

  • Potential gating mechanisms for substrate entry

Molecular Docking:
Docking studies with substrates and potential inhibitors provide insights into:

  • Binding modes and key interaction residues

  • Structure-activity relationships

  • Lead compound optimization strategies

Sequence-Based Analyses:
Advanced bioinformatic approaches offer:

  • Identification of conserved motifs across bacterial species

  • Prediction of post-translational modifications

  • Evolutionary analysis of uppP1 in the context of antibiotic resistance

  • Co-evolution patterns suggesting functional partners

These computational approaches complement experimental studies and can guide hypothesis generation for further laboratory investigation of this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.