Recombinant Pseudomonas stutzeri UPF0114 protein PST_0950 (PST_0950)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
PST_0950; UPF0114 protein PST_0950
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
PST_0950
Target Protein Sequence
MERILENAMYAARWLLAPIYFGLAFALLALAIKFFQEIFHILPMILSISEADLVLTLLSL IDMALVGGLLVMVMISGYENFVSQLDVDEGKEKLDWLGKMDSSSLKLKVAASIVAISSIH LLRMFMDVQQIDSEKLMWYVIIHLTFVVSAFAMGYMDKITKH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic context of Pseudomonas stutzeri and how does it affect research on PST_0950?

Pseudomonas stutzeri is a nonfluorescent denitrifying bacterium within the class Gammaproteobacteria. It belongs to the genus Pseudomonas sensu stricto in group I of Palleroni's DNA-rRNA homology group within the phylum Proteobacteria . The species exhibits remarkable genomic diversity with at least 17 genomovars (groups defined by DNA-DNA hybridization levels), which can significantly impact research on specific proteins like PST_0950. When working with this protein, researchers should precisely document the genomovar of their P. stutzeri strain since protein expression, structure, and function may vary across these genomic groups. The taxonomic identification should utilize both 16S rRNA sequencing and additional housekeeping genes to ensure accurate strain identification, as P. stutzeri has historically been confused with other species like P. mendocina, P. pseudoalcaligenes, and P. putida .

What isolation and culture conditions are optimal for maximizing PST_0950 expression in Pseudomonas stutzeri?

For optimal expression of PST_0950, researchers should implement a two-phase cultivation approach. Initial isolation of P. stutzeri can utilize the elective culture method developed for denitrifiers, using mineral medium with 2% nitrate under anaerobic conditions with carbon sources such as tartrate, malate, succinate, or citrate . For protein expression, switch to aerobic conditions with controlled temperature (optimally 30-37°C) and pH (7.0-7.5) in a rich medium supplemented with specific inducers if the expression system requires it.
For laboratory identification and isolation of suitable strains, combine PCR-based detection using primers specific to P. stutzeri genomovars with selective plating on artificial seawater medium containing ethylene glycol, starch, or maltose . The distinctive wrinkled colony morphology of P. stutzeri facilitates identification, allowing detection of one P. stutzeri colony among thousands of other bacterial colonies . When transitioning to recombinant protein production, optimize expression conditions through small-scale cultures testing various induction times, temperatures, and inducer concentrations before scaling up.

How do the physiological properties of Pseudomonas stutzeri impact experimental design for PST_0950 purification?

The unique physiological properties of P. stutzeri necessitate specific considerations when designing purification protocols for PST_0950. As a rod-shaped bacterium with strictly respiratory metabolism and positive catalase and oxidase activity , cell disruption methods must be carefully selected to preserve protein integrity while effectively breaking down the cell wall.
The denitrification capabilities of P. stutzeri may affect protein extraction conditions, particularly if the strain was grown under anaerobic conditions, which can alter membrane composition and protein-membrane interactions. When designing purification protocols, consider that P. stutzeri's ability to utilize various carbon sources, including starch and maltose , may result in contaminating polysaccharides that need to be removed during early purification steps.
Implement a multi-step purification strategy that begins with ammonium sulfate precipitation or ion exchange chromatography, followed by affinity chromatography if PST_0950 has been tagged, and conclude with size exclusion chromatography to achieve high purity. Throughout this process, maintain buffers at pH 7.0-7.5 to mirror the optimal growth conditions of P. stutzeri, and include protease inhibitors to prevent degradation from endogenous proteases.

What recombinant expression systems are most effective for producing functional PST_0950?

For optimal recombinant expression of PST_0950, researchers should evaluate multiple expression systems based on experimental requirements. E. coli expression systems (particularly BL21(DE3) derivatives) offer high yield and straightforward genetic manipulation, making them suitable for structural studies requiring large protein quantities. For functional studies where post-translational modifications may be critical, consider eukaryotic expression systems like Pichia pastoris or mammalian cell lines.
When using E. coli, optimize codon usage for PST_0950's sequence, as P. stutzeri has a G+C content between 60-66 mol% , which may lead to rare codon issues in E. coli. Test multiple fusion tags (His, GST, MBP) to identify which provides the best combination of solubility and activity. For challenging expression cases, consider cell-free protein synthesis systems which bypass cellular toxicity issues.
Methodology should include small-scale expression tests across multiple conditions (temperature, media composition, induction timing) before scaling up production. Monitor protein quality through activity assays and structural integrity analysis (circular dichroism, thermal shift assays) to ensure the recombinant protein maintains its native conformation and function.

How can directed evolution approaches be applied to enhance PST_0950 functional properties?

Directed evolution represents a powerful strategy for enhancing PST_0950's functional properties through iterative cycles of mutation and selection. To implement this approach effectively, first establish a robust high-throughput screening assay that accurately reports on the specific property you aim to enhance (thermostability, substrate specificity, catalytic efficiency).
A model-guided directed evolution approach can significantly reduce experimental burden while improving outcomes . This strategy employs machine learning to map protein sequence to fitness, predicting variant performance without exhaustive experimental testing . For PST_0950, begin by generating an initial library using error-prone PCR or site-directed mutagenesis focused on active site residues. After screening, use the sequence-function data to train a deep learning model that predicts variant fitness .
In subsequent rounds, employ both random masking and importance masking strategies to select positions for mutation . Random masking introduces diversity across the protein sequence, while importance masking focuses mutations on residues predicted to significantly impact function . Implement a beam search approach with larger beam sizes (e.g., 16-32) to accelerate convergence toward higher fitness values .
For optimal results, balance exploitation (refining successful mutations) with exploration (testing novel mutations) in each iteration. This can be achieved by selecting parent sequences from both the current round's high-performers and previous rounds' populations . This guarantees that if mutations reduce fitness, the pipeline will revert to superior variants from preceding iterations .

What challenges might researchers encounter when analyzing the structural properties of PST_0950, and how can these be addressed?

Structural analysis of PST_0950 presents several significant challenges that require strategic methodological approaches. As a UPF0114 family protein with limited characterization, researchers may encounter difficulties in obtaining high-resolution structures due to potential flexibility, solubility issues, or crystallization resistance.
For X-ray crystallography attempts, implement a multi-factorial approach testing various crystallization conditions, protein concentrations, and additives. Consider surface entropy reduction mutagenesis to replace flexible, high-entropy surface residues with alanines, potentially improving crystal packing. If traditional crystallization fails, explore alternative approaches such as cryo-electron microscopy for structural determination, which can succeed with proteins recalcitrant to crystallization.
For NMR studies, isotopic labeling (15N, 13C) of PST_0950 will be necessary, requiring expression in minimal media with labeled nitrogen and carbon sources. Address potential aggregation issues by screening buffer conditions with differential scanning fluorimetry or light scattering techniques. If the full-length protein proves challenging, consider a divide-and-conquer approach analyzing discrete domains separately.
Computational approaches can provide valuable structural insights when experimental methods face limitations. Employ AlphaFold2 or RoseTTAFold to generate predicted structures, but validate these predictions with limited experimental data such as circular dichroism spectra or small-angle X-ray scattering. The confidence metrics of these models (pLDDT scores) indicate reliability, with values above 90 suggesting high confidence regions and values below 50 indicating potentially disordered regions .

How can researchers effectively investigate protein-protein interactions involving PST_0950 in Pseudomonas stutzeri cellular contexts?

Investigating protein-protein interactions (PPIs) involving PST_0950 in native cellular contexts requires a multi-faceted approach combining in vivo, in vitro, and computational methods. Begin with proximity-dependent biotin identification (BioID) or APEX2 proximity labeling, where PST_0950 is fused to a biotin ligase, allowing biotinylation of proximal proteins in living P. stutzeri cells. This approach captures both stable and transient interactions in the native cellular environment.
Cross-validate identified interactions using co-immunoprecipitation (Co-IP) with PST_0950-specific antibodies or epitope-tagged PST_0950 expressed at near-physiological levels. For quantitative interaction mapping, implement SILAC (Stable Isotope Labeling with Amino acids in Cell culture) to distinguish true interactors from background contaminants. Consider that P. stutzeri's metabolic diversity means growth conditions can dramatically alter the interactome; systematically investigate PST_0950 interactions under relevant physiological conditions (aerobic vs. anaerobic, different carbon sources).
To determine the functional significance of identified interactions, employ CRISPR interference (CRISPRi) to selectively downregulate interaction partners and observe phenotypic effects. For structural characterization of key complexes, use cross-linking mass spectrometry (XL-MS) to identify residues in close proximity, providing spatial constraints for computational modeling of the complex structure.
When publishing PPI data, document the genomovar of your P. stutzeri strain, as the high genetic diversity across genomovars (often below 50% similarity in DNA-DNA hybridizations between different genomovars) may result in variant interaction networks.

What computational approaches can predict the functional role of PST_0950 within the metabolic network of Pseudomonas stutzeri?

To predict PST_0950's functional role within P. stutzeri's metabolic network, implement a multi-scale computational approach integrating sequence analysis, structural predictions, and systems biology methods. Begin with advanced homology detection using profile-hidden Markov models to identify distant homologs with known functions, providing initial functional hypotheses.
For structural insights, leverage machine learning approaches like AlphaFold2 to generate high-confidence 3D models, then perform structural similarity searches against databases of characterized proteins. Analyze predicted binding pockets and conserved residues using tools like CASTp and ConSurf to identify potential ligand binding sites or catalytic residues. Complement these approaches with molecular dynamics simulations to explore conformational flexibility and potential allosteric sites.
At the systems level, integrate PST_0950 into genome-scale metabolic models of P. stutzeri, using flux balance analysis to predict metabolic changes when PST_0950 is altered. Apply context-based methods like phylogenetic profiling and gene neighborhood analysis to identify proteins whose evolutionary patterns correlate with PST_0950, suggesting functional associations.
To validate computational predictions, design targeted biochemical assays based on the highest-confidence predictions. For example, if structural analysis suggests nucleotide binding, perform thermal shift assays with various nucleotides to detect stabilizing interactions. Document the genomovar origin of the PST_0950 sequence used for analysis, as P. stutzeri's genomic diversity may influence functional predictions across strains .

What purification protocol provides optimal yield and purity for recombinant PST_0950?

A robust purification protocol for recombinant PST_0950 requires careful optimization at each step to maximize yield while maintaining protein integrity and activity. Begin with cell lysis using a method that balances efficiency with gentleness - sonication with cooling intervals typically works well for P. stutzeri, but buffer composition is critical. Include 1-2 mM EDTA to chelate metal ions that might activate proteases, 5-10 mM β-mercaptoethanol to maintain reduced cysteines, and a protease inhibitor cocktail optimized for bacterial proteins.
For initial capture, immobilized metal affinity chromatography (IMAC) using a His-tag offers high selectivity when PST_0950 is expressed with an N-terminal or C-terminal 6xHis tag. Optimize imidazole concentrations in binding (10-20 mM), washing (20-50 mM), and elution (250-300 mM) buffers to reduce non-specific binding while maximizing target protein recovery. Consider that P. stutzeri proteins may have different metal-binding characteristics due to the organism's ability to interact with toxic metals , potentially affecting IMAC performance.
Follow IMAC with ion-exchange chromatography, selecting the resin based on PST_0950's predicted isoelectric point. This step effectively removes contaminants with similar affinity for IMAC but different charge properties. Finally, size exclusion chromatography provides both purification and buffer exchange capabilities, allowing assessment of PST_0950's oligomeric state.
Throughout purification, monitor protein quality using activity assays specific to PST_0950's predicted function, as well as SDS-PAGE and western blotting. For structural studies, verify homogeneity using dynamic light scattering. The purification yield can be optimized by maintaining temperature at 4°C throughout all steps and including stabilizing agents like glycerol (10%) in storage buffers.

How can researchers design reliable activity assays for PST_0950 when its precise function remains unclear?

Designing reliable activity assays for a protein with unclear function requires a systematic approach exploring potential biochemical activities based on structural, evolutionary, and contextual clues. For PST_0950, begin by examining sequence conservation patterns across the UPF0114 family to identify absolutely conserved residues that may participate in catalysis or substrate binding.
Implement a tiered screening approach starting with broad functional category assays. Test for common enzymatic activities including hydrolase, transferase, oxidoreductase, and kinase functions using generic substrates for each class. For example, screen various p-nitrophenyl esters to detect potential hydrolase activity, or use malachite green assays to detect phosphate release indicative of ATPase or phosphatase activity.
Contextual genomic information can provide valuable clues for assay design. Analyze the genomic neighborhood of PST_0950 in various P. stutzeri strains to identify consistently co-located genes, as functionally related genes often cluster together. Additionally, examine gene expression patterns across different growth conditions, particularly those associated with P. stutzeri's distinctive metabolic capabilities such as denitrification, pollutant degradation, or metal interactions , to identify conditions that upregulate PST_0950.
Once candidate activities are identified, develop more specific quantitative assays. For each potential function, establish assay controls including heat-inactivated protein and catalytic site mutants based on conserved residues. Document all reaction conditions meticulously, including buffer composition, pH, temperature, and metal ion requirements, as these parameters can significantly impact activity detection.

What strategies can address solubility challenges when expressing recombinant PST_0950?

Addressing solubility challenges for recombinant PST_0950 requires a comprehensive, multi-faceted approach targeting various aspects of protein expression and folding. Begin by optimizing the expression construct itself - evaluate multiple fusion partners known to enhance solubility, such as maltose-binding protein (MBP), NusA, or SUMO tags. Position the tag at both N-terminal and C-terminal positions to determine optimal configuration.
Expression conditions significantly impact solubility. Implement a systematic screening approach varying temperature (15°C, 20°C, 25°C, 30°C), induction time points (early, mid, or late logarithmic phase), and inducer concentration (ranging from 0.1 mM to 1.0 mM IPTG for lac-based systems). Lower temperatures slow protein synthesis, often allowing more time for proper folding and reducing inclusion body formation.
Buffer optimization is crucial for maintaining solubility during purification. Design a factorial screen testing various pH values (6.0-9.0), salt concentrations (50-500 mM NaCl), and additives including glycerol (5-20%), non-detergent sulfobetaines (NDSB-201, NDSB-256), and amino acid additives (arginine, proline) known to suppress aggregation. For each condition, quantify soluble protein yield using activity assays or western blotting.
If standard approaches fail, consider directed evolution approaches guided by machine learning as described in recent literature . This involves creating libraries of PST_0950 variants through random or site-directed mutagenesis, then selecting for improved solubility. Machine learning models can predict promising mutations based on initial screening data, reducing the experimental burden of testing large numbers of variants .
For structural studies requiring high protein concentrations, implement a stepwise concentration procedure, monitoring aggregation via dynamic light scattering after each concentration step. Include stabilizing excipients like trehalose or sucrose (50-100 mM) to maintain solubility at higher concentrations.

How can researchers effectively investigate the role of PST_0950 in Pseudomonas stutzeri's stress response mechanisms?

To comprehensively investigate PST_0950's role in P. stutzeri's stress response mechanisms, implement a multi-layered approach combining genetic manipulation, physiological characterization, and molecular analyses. Begin by creating both knockout and overexpression strains of PST_0950 using CRISPR-Cas9 or homologous recombination techniques. When designing these genetic constructs, consider P. stutzeri's natural transformation capabilities, which can facilitate the introduction of foreign DNA .
Expose wild-type and mutant strains to various stressors relevant to P. stutzeri's ecological niches, including oxidative stress (H₂O₂, paraquat), metal stress (focusing on metals P. stutzeri is known to interact with ), osmotic stress, pH extremes, and nutrient limitation. Monitor growth kinetics, survival rates, and biofilm formation under each condition. Implement a factorial experimental design to identify potential interaction effects between multiple stressors.
For molecular characterization, combine transcriptomics and proteomics to create a systems-level view of PST_0950's role. Perform RNA-seq comparing wild-type and PST_0950 mutant strains under both normal and stress conditions, focusing on differential gene expression patterns. Complement this with quantitative proteomics using SILAC or TMT labeling to identify proteins whose abundance changes significantly in response to PST_0950 manipulation.
To determine PST_0950's specific molecular function during stress, perform chromatin immunoprecipitation (ChIP-seq) if structural predictions suggest DNA-binding capability, or protein co-immunoprecipitation followed by mass spectrometry to identify stress-specific interaction partners. Additionally, utilize fluorescently-tagged PST_0950 to track subcellular localization changes during stress exposure.
For metabolism-related effects, implement metabolic flux analysis using 13C-labeled substrates to identify pathways affected by PST_0950 absence or overexpression during stress conditions. This is particularly relevant given P. stutzeri's metabolic versatility and ability to utilize various carbon sources .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.