Recombinant Pseudomonas stutzeri UPF0761 membrane protein PST_2825 (PST_2825)

Shipped with Ice Packs
In Stock

Description

Production and Expression

A. Host System
Pseudomonas stutzeri is increasingly used as an alternative to E. coli for membrane protein production due to its:

  • Growth Efficiency: Cultivated under standard conditions (e.g., LB media, 37°C) .

  • Antibiotic Resistance: Effective with kanamycin, tetracycline, and gentamicin .

  • Yield: Success rates comparable to E. coli, with milligram-scale production achievable .

Expression Workflow

  1. Cloning: Insertion into the pL2020 vector using the P<sub>BAD</sub> promoter for arabinose-induction .

  2. Induction: Optimal expression triggered by arabinose (0.1-0.5% w/v) .

  3. Screening: GFP folding assay to assess folding quality .

  4. Purification: Nickel-affinity chromatography followed by size-exclusion chromatography .

C. Advantages Over E. coli

FactorPseudomonas stutzeriE. coli
Membrane MimicryCloser to native eukaryotic membranesThinner, less rigid membranes
ToxicityBiosafety Level 1Biosafety Level 1
Protein StabilityImproved for certain targetsVariable

Research Applications and Findings

Key Research Insights

  1. Production Efficiency:

    • Success Rate: 20/36 targets produced at high yields in P. stutzeri vs. E. coli .

    • Large-Scale Purification: STM2913 transporter purified to homogeneity in milligram quantities .

  2. Functional Studies:

    • Lipophilicity: Integral membrane proteins alter membrane stiffness, influencing protein-membrane interactions .

    • Orientation: Positive-inside rule (Arg/Lys preference in cytoplasmic leaflets) validated via dsTβL assays .

Challenges and Limitations

  • Functional Annotation: Limited data on PST_2825’s specific role in metabolism or signaling .

  • Availability: Not commercially available in some catalogs , though suppliers like Creative BioMart and GeneBioSystems offer custom synthesis .

  • Stability: Requires strict cold storage to prevent aggregation .

Future Directions

  • Structural Elucidation: Cryo-EM or X-ray crystallography to resolve tertiary structure.

  • Functional Screening: High-throughput assays to identify binding partners or substrates.

  • Host Optimization: Engineering P. stutzeri strains for enhanced membrane protein production.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
PST_2825; UPF0761 membrane protein PST_2825
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Pseudomonas stutzeri (strain A1501)
Target Names
PST_2825
Target Protein Sequence
MHQRIDNTFEFGRFLVRRFMADQGPQSAAALTYTTLFAVVPMMTVTFAMLSAIPAFKGVG EQIQFYIFNNFIPSTGATIQEYLLAFTSQARQLTWFGVGFLMATALMMLLTIEKAFNTIW RVRQPRRGVSSFLLYWAILSLGPLLLGAGFATSTYIASLSLISGPYALIGVGTLIKVMPL LLSVAAFTLIYAAVPNTRVPLRHALVGGVFTAVLFEAAKQMFGVYVSYFPSYQLIYGAFA AVPLFLLWIYLSWMIVLFGAELVCGLSSSQQWRRRPLPRLLVMLMLLRNLHERQQEGREL HLRDLHKAGLRLPEDEWDDILGFFEQEQLVCRTGSGGWVLCRDLNHYSLDQLLRCNPWPL SARVELPEQLNEPWYPTLRRSLELLQQEQANLFGGSLADWLQANGDKKRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pseudomonas stutzeri UPF0761 membrane protein PST_2825?

PST_2825 is a membrane protein from Pseudomonas stutzeri (strain A1501) classified as part of the UPF0761 family (where UPF designates uncharacterized protein family). It is a full-length protein consisting of 410 amino acids that functions as a membrane-associated protein. When produced recombinantly, it typically includes a tag (though the specific tag type may vary depending on the production process) and is stored in a Tris-based buffer with 50% glycerol for stability . The protein is referenced in the UniProt database with the accession number A4VNB9, indicating its cataloging in standardized protein databases used by researchers worldwide .

Why is Pseudomonas stutzeri being investigated as an alternative host for membrane protein expression?

Pseudomonas stutzeri has emerged as a promising alternative expression host for membrane proteins due to limitations frequently encountered with traditional expression systems. While Escherichia coli remains the most commonly used prokaryotic host for protein production, studies on membrane proteins are often hampered by insufficient yields, improper folding, or lack of functionality . P. stutzeri offers potential advantages for expressing certain membrane proteins that prove difficult to produce in E. coli.

The interest in P. stutzeri stems from its distinct membrane composition and protein folding machinery, which may better accommodate certain classes of membrane proteins, potentially including those from related Pseudomonas species or other gram-negative bacteria with similar membrane characteristics . Researchers investigating PST_2825 or related membrane proteins might consider P. stutzeri as an expression system, particularly if traditional hosts yield poor results.

What are the optimal storage and handling conditions for recombinant PST_2825?

For optimal preservation of recombinant PST_2825 integrity and activity, adhere to the following storage protocols:

  • Store stock solutions at -20°C for regular storage

  • For extended preservation, maintain at -20°C or preferably -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles, as these significantly compromise protein stability

When planning experiments, researchers should create appropriate aliquots upon receipt of the protein to minimize freeze-thaw events. The provided storage buffer (Tris-based with 50% glycerol) is optimized for this specific protein, and researchers should avoid buffer exchanges unless absolutely necessary for downstream applications .

How should experiments involving PST_2825 be designed to ensure statistical rigor?

When designing experiments involving PST_2825, researchers should implement robust experimental design principles to ensure valid, reliable, and replicable results. The experimental design should incorporate:

  • Clear definition of research questions and objectives before beginning experimentation

  • Careful selection of appropriate dependent variables (responses), independent variables (factors), and control variables

  • Adequate sample sizes determined through power analysis to detect biologically meaningful effects

  • Appropriate randomization and blinding procedures to minimize bias

  • Inclusion of both positive and negative controls to validate experimental procedures

For membrane proteins like PST_2825 specifically, additional considerations include:

  • Controls for protein stability and activity throughout the experimental timeline

  • Verification of proper membrane localization or reconstitution

  • Accounting for potential effects of any tags or fusion partners

  • Validation across multiple batches of recombinant protein to ensure consistency

The implementation of factorial designs, where multiple variables are manipulated simultaneously, can be particularly valuable for efficiently exploring the effects of different experimental conditions on PST_2825 function or expression .

What approaches are most effective for studying PST_2825's potential protein-protein interactions?

To investigate protein-protein interactions involving membrane proteins like PST_2825, researchers should consider specialized techniques that account for the challenges posed by the hydrophobic nature of membrane proteins. Recommended methodological approaches include:

TechniqueAdvantagesLimitationsSpecial Considerations for PST_2825
Membrane-based yeast two-hybridAllows detection of interactions in membrane environmentLimited to interactions that can occur in yeastMay require optimization of expression constructs
Cross-linking coupled with mass spectrometryCaptures transient interactions in native environmentComplex data analysisRequires optimization of cross-linking conditions
Co-immunoprecipitationDetects relatively stable interactionsMay disrupt some membrane protein interactionsRequires careful selection of detergents
Proximity labeling (BioID, APEX)Identifies nearby proteins in living cellsMay capture non-specific proximitiesFusion constructs must maintain protein localization
Surface plasmon resonanceProvides binding kineticsRequires purified componentsProper reconstitution of PST_2825 is critical

Each experimental approach should include appropriate controls to distinguish specific from non-specific interactions, including the use of unrelated membrane proteins as negative controls and known interacting pairs as positive controls where available .

How does oxidative stress affect membrane protein expression in Pseudomonas stutzeri, and what implications might this have for PST_2825 research?

Studies examining Pseudomonas stutzeri's response to oxidative stress induced by nano-sized zero-valent iron (nZVI) particles provide valuable insights into how membrane proteins, potentially including PST_2825, might be regulated under stress conditions. The cellular response to oxidative stress in P. stutzeri involves a coordinated modulation of membrane protein expression and activation of detoxification mechanisms.

Research has demonstrated that exposure to oxidative stressors triggers:

  • Significant upregulation of katB gene expression (5.7-fold higher than control), encoding catalase for hydrogen peroxide detoxification

  • Increased production of Fe-superoxide dismutase (SodB), which functions as a superoxide scavenger and is produced exclusively under high iron conditions

  • Downregulation of membrane proteins involved in iron uptake, including iron ABC transporter periplasmic protein and TonB-dependent siderophore receptor

  • Upregulation of chaperones and heat shock proteins that help maintain proper protein folding

These findings suggest a sophisticated stress response mechanism where P. stutzeri actively regulates its membrane proteome to mitigate oxidative damage. For PST_2825 research, these observations indicate that oxidative conditions may significantly alter the expression or function of membrane proteins, necessitating careful control of oxidative conditions in experimental designs. Additionally, researchers should consider evaluating PST_2825 expression and function under various oxidative conditions to determine if it plays a role in stress response pathways .

What molecular techniques are most appropriate for studying PST_2825 expression regulation?

To investigate the regulation of PST_2825 expression at the molecular level, researchers should employ a multi-omics approach that captures transcriptional, translational, and post-translational regulatory mechanisms:

For transcriptional analysis:

  • RT-qPCR using appropriate reference genes (such as 16S rRNA as used in P. stutzeri studies) to quantify PST_2825 mRNA levels under different conditions

  • Promoter-reporter fusion assays to identify regulatory elements controlling PST_2825 expression

  • ChIP-seq to identify transcription factors that may bind to the PST_2825 promoter region

For translational and post-translational analysis:

  • 2D gel electrophoresis coupled with mass spectrometry (as demonstrated in P. stutzeri proteomic studies) to identify changes in protein abundance

  • Pulse-chase experiments to determine protein turnover rates

  • Western blotting with specific antibodies to track protein levels and potential post-translational modifications

The integrative analysis demonstrated in studies of P. stutzeri's response to nZVI exposure, combining transcriptomic and proteomic approaches, represents a model methodology that could be adapted for PST_2825 regulation studies .

What challenges arise in the structural characterization of membrane proteins like PST_2825?

The structural characterization of membrane proteins such as PST_2825 presents unique challenges due to their hydrophobic nature and dependence on lipid environments for proper folding and function. Researchers face several obstacles that require specialized approaches:

ChallengeMethodological SolutionsTechnical Considerations
Protein extraction from membraneOptimize detergent screening protocolsTest multiple detergent classes (ionic, non-ionic, zwitterionic) for extraction efficiency while maintaining function
Maintaining native conformationUse of nanodiscs, amphipols, or lipid cubic phaseDifferent membrane mimetics may be required for different analytical techniques
Low expression yieldsExplore alternative expression systems, including P. stutzeri itselfConsider fusion partners to enhance expression and folding
Crystallization difficultiesLipid cubic phase crystallization or antibody-mediated crystallizationExtensive screening of crystallization conditions specific for membrane proteins
NMR signal complexitySelective isotopic labeling strategiesMay require deuteration in addition to 13C/15N labeling
Cryo-EM sample preparationOptimization of grid preparation and vitrificationConsider detergent concentration effects on contrast

Successful structural characterization typically requires an iterative approach, where multiple techniques (X-ray crystallography, NMR, cryo-EM) are employed in parallel, with findings from each method informing the optimization of others. For PST_2825 specifically, its classification as a UPF0761 family member suggests limited structural information may be available from homology modeling, making experimental determination particularly valuable .

What statistical approaches are recommended for analyzing PST_2825 expression data?

For robust analysis of PST_2825 expression data, researchers should implement statistical approaches tailored to the experimental design and data characteristics. Based on principles from experimental design literature and proteomic studies in P. stutzeri, the following analytical strategies are recommended:

  • For comparing expression levels across multiple conditions:

    • Analysis of Variance (ANOVA) followed by appropriate post-hoc tests when assumptions of normality and homogeneity of variance are met

    • Non-parametric alternatives such as Kruskal-Wallis test when data violate parametric assumptions

    • Mixed-effects models when incorporating both fixed and random effects (e.g., biological replicates)

  • For multivariate data analysis (common in proteomics/transcriptomics):

    • Principal Component Analysis (PCA) to visualize patterns and groupings in the data, as successfully employed in P. stutzeri proteomic studies

    • Hierarchical clustering to identify proteins with similar expression patterns

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify variables most important for group separation

  • For time-course experiments:

    • Repeated measures ANOVA or mixed-effects models

    • Time series analysis methods to account for temporal dependencies

Regardless of the specific approach, researchers should:

  • Apply appropriate corrections for multiple comparisons (e.g., Bonferroni, False Discovery Rate)

  • Report effect sizes along with p-values

  • Conduct power analyses to ensure adequate sample sizes

  • Validate findings across independent experimental replicates

How can researchers integrate transcriptomic and proteomic data to understand PST_2825 function?

To gain comprehensive insights into PST_2825 function, researchers should employ integrative multi-omics approaches that combine transcriptomic and proteomic data. Based on the methodology used in P. stutzeri studies examining responses to stress conditions, the following integration strategy is recommended:

  • Generate complementary datasets:

    • Transcriptomic data via RT-qPCR (targeted) or RNA-Seq (genome-wide)

    • Proteomic data through techniques like DIGE or LC-MS/MS

    • Potentially include additional layers such as metabolomics or interactomics

  • Perform correlation analysis:

    • Calculate Pearson or Spearman correlations between transcript and protein levels for PST_2825 and functionally related genes

    • Identify cases of concordant vs. discordant regulation that may indicate post-transcriptional regulation mechanisms

  • Pathway enrichment analysis:

    • Map integrated data to known biological pathways

    • Identify enriched pathways or gene ontology terms associated with conditions affecting PST_2825 expression

  • Network analysis:

    • Construct gene-protein interaction networks incorporating PST_2825

    • Identify hub proteins or genes that may regulate or interact with PST_2825

    • Use network topology to predict potential functions based on guilt-by-association principles

The P. stutzeri study examining responses to nZVI exposure demonstrates the value of this integrative approach, where transcriptional analysis identified upregulation of oxidative stress response genes (katB), while proteomic analysis revealed corresponding changes in protein abundance (SodB upregulation) and provided additional insights into the cellular response mechanisms. A similar strategy applied to PST_2825 could reveal functional aspects not apparent from single-omics approaches .

What methodological approaches can address reproducibility challenges in PST_2825 research?

Ensuring reproducibility in membrane protein research, particularly for poorly characterized proteins like PST_2825, requires rigorous methodological approaches throughout the research lifecycle. Researchers should implement the following strategies:

  • Experimental design considerations:

    • Conduct systematic power analyses to determine appropriate sample sizes

    • Pre-register experimental protocols and analysis plans

    • Implement randomization and blinding procedures where appropriate

    • Include all necessary controls (positive, negative, vehicle)

  • Standardization of protein production and handling:

    • Develop and adhere to standard operating procedures for protein expression and purification

    • Implement quality control checkpoints (e.g., purity assessment, activity assays)

    • Document all batch information and storage conditions meticulously

  • Data collection and analysis transparency:

    • Maintain comprehensive records of all raw data

    • Document all data processing steps and parameter choices

    • Utilize open-source analytical tools with version control

    • Share data and code through repositories

  • Validation across contexts:

    • Replicate key findings using alternative methodological approaches

    • Verify results across different protein batches and experimental conditions

    • Consider multi-laboratory validation for critical findings

The example of P. stutzeri research examining cellular responses to nZVI demonstrates effective practices, where researchers combined multiple methodological approaches (microscopy, transcriptomics, proteomics) to triangulate findings, strengthening the evidence for oxidative stress response mechanisms. Similar methodological triangulation would be valuable for PST_2825 functional characterization .

What are promising research avenues for elucidating PST_2825 function?

Based on current understanding of UPF0761 family proteins and Pseudomonas stutzeri membrane biology, several promising research directions could advance knowledge of PST_2825 function:

  • Comparative genomics and evolutionary analysis:

    • Identify homologs across bacterial species

    • Analyze conservation patterns and co-evolution with other proteins

    • Examine genomic context for clues to function (e.g., operon structure)

  • Targeted gene disruption studies:

    • Generate PST_2825 knockout strains in P. stutzeri

    • Perform comprehensive phenotypic characterization under various conditions

    • Conduct complementation studies to confirm phenotype-genotype relationships

  • Localization and topology mapping:

    • Determine precise subcellular localization using fluorescent protein fusions

    • Map membrane topology using approaches like substituted cysteine accessibility method (SCAM)

    • Identify potential functional domains based on structural predictions

  • Response to environmental challenges:

    • Evaluate expression and localization under different stress conditions (similar to the nZVI studies)

    • Examine potential roles in oxidative stress response, given the established relationship between membrane proteins and stress response in P. stutzeri

  • Integration into known membrane protein complexes:

    • Investigate potential participation in established membrane protein complexes

    • Examine co-expression patterns with other membrane proteins

    • Apply protein-protein interaction studies using techniques optimized for membrane proteins

These research directions should be pursued using the experimental design principles outlined in the literature, with careful attention to controls, replicability, and integration of multiple methodological approaches .

How might PST_2825 research contribute to broader understanding of membrane protein biology?

Investigation of PST_2825 represents an opportunity to advance fundamental understanding of membrane protein biology, particularly for proteins of unknown function. This research could contribute to several broader scientific areas:

  • Membrane protein evolution and adaptation:

    • Insights into how novel membrane protein families emerge and specialize

    • Understanding of how membrane proteins adapt to specific bacterial lifestyles and environments

    • Identification of conserved structural elements that might represent fundamental membrane protein design principles

  • Membrane protein folding and quality control:

    • Elucidation of factors influencing proper membrane integration and folding

    • Identification of chaperones or other factors that assist in membrane protein biogenesis

    • Understanding how bacteria maintain membrane proteostasis under stress conditions

  • Alternative expression systems development:

    • Refinement of P. stutzeri as an expression platform for challenging membrane proteins

    • Identification of factors that contribute to successful membrane protein production

    • Development of predictive models for optimal expression system selection

  • Stress response mechanisms:

    • Further understanding of how membrane proteome remodeling contributes to bacterial stress adaptation

    • Potential discovery of novel stress response mechanisms involving membrane proteins

    • Insights into coordination between iron homeostasis and oxidative stress defenses in bacteria

The methodological approaches developed for PST_2825 research could also advance the broader field by establishing optimized protocols for studying poorly characterized membrane proteins, potentially accelerating functional annotation of the numerous membrane proteins of unknown function across bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.