Recombinant Pseudomonas syringae pv. phaseolicola ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Role

ATP synthase subunit B (atpF) is integral to the F₀ sector of ATP synthase, which spans the bacterial membrane and drives proton translocation. This process generates a proton gradient used to synthesize ATP via oxidative phosphorylation. While atpF is a housekeeping gene in Pseudomonas, its recombinant form enables controlled studies of ATP synthase assembly, proton transport mechanisms, and energy metabolism .

Key Functional Insights:

  • Proton translocation: Subunit B forms part of the transmembrane channel, working in tandem with subunits A and C to facilitate proton movement .

  • Regulatory interactions: May interact with other F₀ subunits (e.g., subunit A) to modulate ATP synthase activity under varying metabolic conditions.

Production and Purification

The recombinant atpF protein is produced via heterologous expression in E. coli, leveraging optimized expression vectors. Critical steps include:

  1. Cloning: Insertion of the atpF coding sequence into a plasmid vector.

  2. Expression: Induction of protein synthesis in E. coli under controlled conditions.

  3. Purification: Affinity chromatography using the His-tag, followed by lyophilization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; PSPPH_5211; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
atpF
Target Protein Sequence
MNINATLIGQSVAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK AGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDAL RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of ATP synthase subunit b (atpF) in Pseudomonas syringae pv. phaseolicola?

ATP synthase subunit b (atpF) in P. syringae pv. phaseolicola serves as a critical structural component of the F-type ATP synthase (F₁F₀), functioning primarily within the peripheral stalk that connects the catalytic head (α₃β₃) to the membrane-embedded a-subunit. This peripheral stalk is essential for preventing rotation of the a-subunit during catalysis, thereby maintaining the integrity of the proton channel and enabling efficient ATP synthesis.

Unlike conventional bacterial ATP synthases that contain a single peripheral stalk, recent structural studies of ATP synthases from photosynthetic bacteria suggest some bacterial lineages may contain two peripheral stalks, which potentially increases proton translocation efficiency . While the exact stoichiometry in P. syringae pv. phaseolicola has not been fully characterized, the protein sequence indicates high conservation with other peripheral stalk components involved in energy coupling between the F₁ and F₀ sectors.

How does the amino acid sequence of P. syringae pv. phaseolicola atpF compare to other Pseudomonas strains?

The amino acid sequence of P. syringae pv. phaseolicola atpF shares significant homology with other Pseudomonas species, particularly within the P. syringae complex. Comparative sequence analysis reveals:

Pseudomonas StrainSequence Identity (%)Conserved Structural Domains
P. syringae pv. syringae B728a~95-98%Transmembrane helix, coiled-coil region, α-subunit binding domain
P. syringae pv. tomato DC3000~94-96%Transmembrane helix, coiled-coil region, α-subunit binding domain
P. aeruginosa~75-78%Transmembrane helix, coiled-coil region, α-subunit binding domain
P. fluorescens~76-79%Transmembrane helix, coiled-coil region, α-subunit binding domain

The high sequence conservation among P. syringae pathovars reflects their close evolutionary relationship, while the more distant Pseudomonas species show greater sequence divergence in the atpF gene . The N-terminal transmembrane domain tends to be highly conserved across bacterial species, while the C-terminal region that interacts with the F₁ sector shows more variability.

What are the optimal expression systems for producing recombinant P. syringae pv. phaseolicola atpF protein?

The optimal expression of recombinant P. syringae pv. phaseolicola atpF requires careful consideration of expression systems to ensure proper folding and solubility. Based on research methodologies:

  • Bacterial Expression Systems:

    • E. coli BL21(DE3) with pET vector systems typically yield 5-10 mg/L culture when induced at 18°C overnight with 0.5 mM IPTG

    • Codon-optimized constructs improve expression by 30-40% in E. coli

    • Fusion tags such as MBP or SUMO enhance solubility significantly compared to His-tag alone

  • Expression Parameters Optimization:

ParameterOptimal ConditionEffect on Yield
Induction temperature16-18°CIncreases soluble fraction by 60-70%
IPTG concentration0.2-0.5 mMBalances expression level and solubility
MediumTB or auto-induction2-3× higher yield than LB medium
Induction OD₆₀₀0.6-0.8Ensures cells are in exponential growth phase
  • Co-expression Strategies:

    • Co-expression with chaperones GroEL/GroES improves correct folding

    • Co-expression with other ATP synthase subunits (particularly atpE or atpG) increases stability

The methodology must be tailored to experimental objectives, with lower temperature induction and specialized solubility tags being particularly important due to the membrane-associated nature of the native protein .

What purification challenges are specific to recombinant P. syringae pv. phaseolicola atpF, and how can they be overcome?

Purification of recombinant P. syringae pv. phaseolicola atpF presents several unique challenges due to its partially hydrophobic nature and tendency to form insoluble aggregates. Effective strategies include:

  • Solubilization Optimization:

    • Test multiple detergents (DDM, LDAO, or C₁₂E₈) at concentrations just above CMC

    • Incorporation of 5-10% glycerol in lysis buffers reduces aggregation by 40-50%

    • Arginine (50-100 mM) as a buffer additive improves solubility and reduces non-specific interactions

  • Chromatography Strategy:

    • Initial capture using IMAC with cobalt rather than nickel resin reduces non-specific binding

    • Size exclusion chromatography in buffer containing 0.05% detergent separates monomeric from aggregated forms

    • Ion exchange chromatography at pH 8.0 effectively removes contaminating nucleic acids

  • Protein Instability Solutions:

    • Addition of 1 mM ATP to purification buffers enhances stability during storage

    • Flash-freezing in liquid nitrogen with 20% glycerol preserves activity after thawing

    • Storing at concentrations below 1 mg/ml reduces time-dependent aggregation

When purifying for structural studies, consider using amphipathic polymers like amphipols or nanodiscs to stabilize the hydrophobic regions without conventional detergents, which has been shown to improve stability for downstream applications .

How does the structure of ATP synthase differ between P. syringae pv. phaseolicola and other bacterial models?

The structure of ATP synthase in P. syringae pv. phaseolicola exhibits several distinctive features compared to well-characterized bacterial models:

Further structural studies using cryo-EM would be valuable to definitively determine if P. syringae pv. phaseolicola ATP synthase contains structural innovations similar to those found in early photosynthetic bacteria.

What structural techniques have been most effective for analyzing the atpF subunit's role in the ATP synthase complex?

Multiple structural biology techniques have proven effective for analyzing the atpF subunit's role in ATP synthase, each offering complementary insights:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Currently the gold standard for ATP synthase structural studies

    • Resolution of 2.5-3.5 Å achievable for bacterial ATP synthases

    • Particularly valuable for visualizing the peripheral stalk in its native conformation

    • Has revealed unexpected stoichiometries in some bacterial ATP synthases

  • X-ray Crystallography:

    • Historical technique that provided initial insights into F₁ domains

    • Challenging for membrane components like atpF

    • Most successful when applied to soluble domains or fusion constructs

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides insights into dynamics and solvent accessibility

    • Effective for mapping interaction interfaces between atpF and other subunits

    • Can identify conformational changes under different physiological conditions

  • Cross-linking Mass Spectrometry (XL-MS):

    • Valuable for determining proximity relationships

    • Confirms direct interactions between atpF and other subunits

    • Particularly useful for identifying transient interactions

  • Molecular Dynamics Simulations:

    • Provides atomistic insights into stability and dynamics

    • Can model how transmembrane domain of atpF interacts with lipid bilayer

    • Useful for predicting effects of mutations on structural integrity

Integrative structural biology approaches combining multiple techniques offer the most comprehensive understanding of atpF's structural role. Recent advances in Cryo-EM have been particularly transformative, revealing unexpected features such as double peripheral stalks in some bacterial lineages .

How can researchers effectively measure the functional impact of mutations in the P. syringae pv. phaseolicola atpF gene?

Researchers can employ several complementary approaches to measure the functional impact of mutations in the P. syringae pv. phaseolicola atpF gene:

  • In vitro ATPase/ATP Synthase Activity Assays:

    • Purified ATP synthase complexes containing wild-type or mutant atpF can be reconstituted in liposomes

    • ATP synthesis rates can be measured using luciferase-based assays upon generation of a proton gradient

    • ATP hydrolysis activity (reverse reaction) can be quantified through inorganic phosphate detection

  • Bacterial Growth and Bioenergetics Analysis:

    • Complementation studies in atpF deletion strains

    • Growth curve analysis in media with different carbon sources and under various stress conditions

    • Measurement of membrane potential using voltage-sensitive dyes

    • Oxygen consumption rates using Clark-type electrodes

  • Protein-Protein Interaction Studies:

    • Bacterial two-hybrid assays to quantify interaction strength between mutant atpF and other ATP synthase subunits

    • Pull-down assays to assess complex formation efficiency

    • FRET-based approaches to study interactions in living cells

  • Structural Integrity Assessment:

    • Thermal shift assays to measure stability of complexes containing mutant atpF

    • Limited proteolysis to identify regions with altered conformational dynamics

    • Native gel electrophoresis to assess complex assembly

  • In planta Pathogenicity Assays:

    • Bean infection studies with P. syringae pv. phaseolicola strains carrying atpF mutations

    • Measurement of bacterial population dynamics in planta

    • Assessment of disease symptom development and progression

Mutation TypeExpected Functional ImpactRecommended Assays
Transmembrane domain mutationsDisrupted membrane anchoringMembrane fractionation, ATP synthesis in liposomes
α-subunit binding region mutationsImpaired peripheral stalk assemblyPull-down assays, native PAGE, electron microscopy
Coiled-coil domain mutationsReduced stalk rigidityATPase activity under mechanical stress, FRET-based conformational studies
Conserved residue mutationsVaried effects based on positionComprehensive analysis with multiple approaches

Studies have shown that peripheral stalk integrity is crucial for maintaining the efficiency of proton translocation coupled to ATP synthesis, and mutations in atpF can have profound effects on bacterial bioenergetics and consequently on virulence in plant pathogens .

What is the relationship between ATP synthase function and virulence in P. syringae pv. phaseolicola?

The relationship between ATP synthase function and virulence in P. syringae pv. phaseolicola is complex and multifaceted:

  • Energy Production for Virulence Factor Synthesis:

    • ATP synthase provides the energy required for the production of virulence factors such as phaseolotoxin

    • The phaseolotoxin biosynthetic cluster (Pht cluster) consists of 23 genes that require significant energy input for expression and operation

    • Transcriptional profiling has shown that genes involved in aerobic metabolism, including ATP synthase components, are upregulated during plant infection

  • Adaptation to Plant Environment:

    • ATP synthase function is crucial for adapting to pH changes in the plant apoplast during infection

    • Bean leaf extracts and apoplastic fluid trigger differential expression of metabolic genes, including those involved in energy production

    • The ability to maintain PMF (proton motive force) under various environmental conditions is critical for pathogen survival

  • Coordination with Virulence Mechanisms:

    • ATP synthase function appears coordinated with type III secretion system (T3SS) activity

    • Energy-intensive processes like effector protein secretion depend on efficient ATP synthesis

    • Motility and biofilm formation, both important for virulence, require substantial energy input

  • Experimental Evidence:

    • Mutations affecting ATP synthase function result in reduced bacterial growth in planta

    • Reduced ATP synthesis capacity correlates with decreased expression of virulence-associated genes

    • Transcriptional studies show coordinated regulation of energy metabolism and virulence factor production

Research indicates that ATP synthesis is not merely a housekeeping function but is integrated into the virulence program of P. syringae pv. phaseolicola. Disruption of ATP synthase function through mutations in components like atpF can have cascading effects on multiple aspects of bacterial pathogenicity and survival in the plant environment.

How can recombinant P. syringae pv. phaseolicola atpF be used as a tool to study bacterial adaptation to plant hosts?

Recombinant P. syringae pv. phaseolicola atpF can serve as a valuable tool for studying bacterial adaptation to plant hosts through several research applications:

  • Protein Interaction Studies:

    • Recombinant atpF can be used to identify plant proteins that interact with bacterial ATP synthase components

    • Pull-down assays with tagged atpF can reveal potential host targets or immune receptors

    • Investigating whether plant defense responses directly target bacterial bioenergetics

  • Evolutionary Adaptation Analysis:

    • Heterologous expression of atpF variants from different P. syringae pathovars can reveal adaptive changes

    • Complementation studies in various backgrounds can demonstrate functional conservation or divergence

    • Synthetic biology approaches to test chimeric atpF proteins for altered host adaptation

  • Metabolic Adaptation Studies:

    • atpF variants can be used to study how ATP synthesis is optimized for different plant environmental conditions

    • Investigating adaptations to pH fluctuations encountered during infection

    • Analysis of how energy production is balanced with virulence factor expression

  • Structural Biology Applications:

    • Recombinant atpF enables structural studies to reveal potential pathogen-specific features

    • Comparison with non-pathogenic Pseudomonas ATP synthase components

    • Structure-guided design of inhibitors that specifically target pathogen ATP synthases

  • Diagnostic and Detection Applications:

    • Development of antibodies against pathogen-specific epitopes of atpF

    • PCR-based diagnostics targeting polymorphisms in the atpF gene

    • Biosensor development for early detection of pathogen presence

Recent studies have revealed evidence of convergent gene acquisition and homologous recombination in P. syringae genomes, affecting pathways involved in ATP-dependent transport and metabolism . Recombinant atpF can be used to investigate whether such evolutionary processes have resulted in functional adaptations that optimize energy production during plant infection.

What insights can comparative studies of ATP synthase subunit b provide about the evolution of different P. syringae pathovars?

Comparative studies of ATP synthase subunit b (atpF) across P. syringae pathovars offer important insights into their evolution and host adaptation:

  • Phylogenetic Patterns and Selection Pressures:

    • Analysis of atpF sequences reveals patterns of selection pressure across different functional domains

    • Comparison with genome-wide recombination patterns can identify whether ATP synthase components experience distinct evolutionary trajectories

    • Recent studies show that P. syringae phylogroups contain evidence of both recent and ancestral recombination events, with functional pathways involved in ATP-dependent transport showing enrichment for recombination

  • Correlation with Host Range:

    • Comparative analysis of atpF variants can reveal adaptations potentially linked to host range

    • Specific amino acid changes may correlate with adaptation to particular plant hosts

    • Integration with other genomic data can identify co-evolving gene clusters

  • Evidence from Genome-Scale Studies:

    PhylogroupRecent Recombination (%)Ancestral Recombination (%)ATP Metabolism Genes Affected
    2a0.71 ± 1.13%0.49%Variable
    2b1.44 ± 1.16%0.00%Variable
    2b-a (hybrid)27.98-30.54%Not specifiedEnriched for recombination
    Pav2.03 ± 0.06%40.09%Enriched for recombination

    These patterns suggest that ATP metabolism genes, potentially including atpF, may be subject to evolutionary processes that contribute to pathogen emergence and adaptation .

  • Structural and Functional Consequences:

    • Atomic-level structural studies of atpF variants can reveal how evolutionary changes impact ATP synthase function

    • Functional assays comparing ATP synthesis efficiency across variants provide insights into adaptive significance

    • Integration with phenotypic data (virulence, host range) links molecular evolution to ecological adaptation

  • Horizontal Gene Transfer and Gene Acquisition:

    • atpF can serve as a marker to study whether ATP synthase components have been subject to horizontal gene transfer

    • Comparison with other metabolic genes helps identify whether energy production pathways evolve as functional units

    • Correlation with mobile genetic elements that carry virulence factors

Genome-wide transcriptional regulatory network analysis in P. syringae has identified numerous TFs involved in metabolic regulation, with 25 master regulators specifically involved in metabolic pathways . These regulatory networks likely influence the expression and evolution of ATP synthase components, including atpF, across different pathovars.

What are the best approaches for studying the role of ATP synthase in P. syringae pv. phaseolicola pathogenicity?

Investigating the role of ATP synthase in P. syringae pv. phaseolicola pathogenicity requires multiple complementary approaches:

  • Genetic Manipulation Strategies:

    • Construction of conditional atpF mutants using inducible promoters to avoid lethal effects

    • Site-directed mutagenesis targeting specific functional domains rather than complete knockouts

    • CRISPR interference (CRISPRi) for tunable repression of ATP synthase components

    • Complementation with atpF variants from different bacterial species to assess functional conservation

  • In Planta Studies:

    • Bean infection assays with ATP synthase mutants at different stages of infection

    • Confocal microscopy with fluorescently tagged ATP synthase components to track localization during infection

    • Transcriptomics and proteomics to identify coordinated regulation between ATP synthase and virulence factors

    • Metabolomics to assess energy status during different infection phases

  • Biochemical Approaches:

    • ATP/ADP ratio measurements in bacteria isolated from plant tissues

    • Membrane potential assessments during host interaction

    • Proton translocation assays under conditions mimicking the plant apoplast

    • Isolation of intact ATP synthase complexes from bacteria during infection

  • Advanced Imaging Techniques:

    • cryo-ET (electron tomography) of bacterial cells in contact with plant cells

    • Super-resolution microscopy to visualize ATP synthase distribution during infection

    • Correlative light and electron microscopy to link ATP synthase localization with cellular ultrastructure

  • Systems Biology Integration:

    • Network analysis integrating transcriptomics, proteomics, and metabolomics data

    • Mathematical modeling of energy production during different infection stages

    • Simulation of how energy availability constrains virulence factor production

Recent studies have demonstrated that transcriptional profiling of P. syringae pv. phaseolicola in the presence of bean leaf extracts reveals upregulation of genes involved in aerobic metabolism, emphasizing the importance of energy production during infection . Furthermore, genome-wide transcriptional regulatory network analysis has identified master regulators controlling metabolic pathways that likely influence ATP synthase function during pathogenesis .

How can researchers effectively design experiments to investigate the impact of environmental conditions on P. syringae pv. phaseolicola ATP synthase function?

Designing robust experiments to investigate environmental impacts on P. syringae pv. phaseolicola ATP synthase function requires careful consideration of relevant conditions and methodology:

  • Mimicking Plant Apoplastic Conditions:

    • Develop minimal media that accurately replicates apoplastic fluid composition from bean plants

    • Include plant-derived phenolic compounds at physiologically relevant concentrations

    • Establish pH gradient systems that model fluctuations during infection (typically from pH 5.5-6.5)

    • Incorporate controlled iron limitation to mimic host sequestration strategies

  • Temperature Shift Experimental Designs:

    • Implement precise temperature control systems for studying thermoregulation

    • Design experiments with gradual versus sudden temperature shifts (18°C to 28°C)

    • Monitor ATP synthase gene expression and function across temperature gradients

    • Assess correlation with virulence factor production, particularly phaseolotoxin which exhibits temperature-dependent regulation similar to ATP synthase components

  • Multi-Parameter Experimental Approaches:

    ParameterRelevant RangeMeasurement TechniquesExpected Impact on ATP Synthase
    pH4.5-7.0In vivo pH sensors, PMF measurementsAltered proton gradient, efficiency changes
    Temperature16-30°CqPCR, ATP production assaysExpression changes, activity modulation
    Nutrient availabilityCarbon-limited to repleteMetabolomics, ATP/ADP ratioAltered energy demands and production
    Plant defense compounds0-500 μMMembrane integrity assaysPotential uncoupling or inhibition
    Oxygen availabilityAerobic to microaerobicOxygen electrodes, redox sensorsShift to alternative energy production
  • Real-time Monitoring Approaches:

    • Develop reporter strains with fluorescent proteins fused to ATP synthase promoters

    • Employ FRET-based ATP sensors for real-time ATP measurement in living cells

    • Use membrane-potential sensitive dyes to monitor PMF under changing conditions

    • Implement microfluidic systems for precise environmental control during imaging

  • Integration with Host Response:

    • Design co-culture systems with plant cells to study bacterial ATP synthase function during direct interaction

    • Develop plant infection models that allow extraction of bacteria for biochemical analysis at different stages

    • Correlate plant defense responses with changes in bacterial energy metabolism

Studies have shown that P. syringae pv. phaseolicola responds dramatically to plant-derived signals, with substantial transcriptional remodeling of metabolic pathways including those involved in energy production . Additionally, phaseolotoxin production (a key virulence factor) is regulated by temperature in a manner that may be coordinated with ATP synthase function , suggesting shared regulatory mechanisms that should be considered in experimental design.

How can structural insights into P. syringae pv. phaseolicola ATP synthase inform the development of pathogen-specific inhibitors?

Structural insights into P. syringae pv. phaseolicola ATP synthase can guide the development of pathogen-specific inhibitors through several strategic approaches:

  • Exploiting Structural Uniqueness:

    • Identify pathogen-specific structural features in the peripheral stalk region containing atpF

    • Recent studies of ATP synthases from early photosynthetic bacteria have revealed unexpected architectures, suggesting potential unique features in plant pathogens

    • Target interfaces between atpF and other subunits that differ from beneficial soil bacteria

  • Structure-Based Drug Design:

    • Employ computational docking studies targeting the ATP synthase components

    • Focus on regions unique to phytopathogenic bacteria compared to plant ATP synthases

    • Design small molecules that disrupt peripheral stalk integrity without affecting plant ATP synthases

  • Allosteric Modulation Strategies:

    • Identify allosteric sites in atpF that could modulate ATP synthase function

    • Design molecules that lock the peripheral stalk in non-productive conformations

    • Target dynamically important regions identified through molecular dynamics simulations

  • Protein-Protein Interaction Disruptors:

    • Design peptide mimetics that compete for binding interfaces between atpF and other subunits

    • Screen for small molecules that disrupt critical structural interactions

    • Target assembly interfaces to prevent proper complex formation

  • Rational Design Framework:

    Target RegionStructural UniquenessPotential Inhibitor ClassExpected Effect
    atpF-delta interfaceSequence divergence at contact pointsProtein-protein interaction disruptorsDestabilized peripheral stalk
    Transmembrane domainPotential differences in membrane insertionMembrane-active compoundsDisrupted anchoring
    Coiled-coil regionUnique packing featuresHelix-disrupting moleculesReduced stalk rigidity
    a-subunit interaction sitePotential pathovar-specific featuresInterface blockersUncoupled proton flow

Recent advances in understanding the architecture of bacterial ATP synthases, including the discovery of doubled peripheral stalks in some bacteria , suggest that P. syringae ATP synthase might contain unique structural features that could be exploited for specific inhibitor development.

The thermoregulation of certain P. syringae pv. phaseolicola genes, such as those involved in phaseolotoxin production , hints at potential regulatory mechanisms that might affect ATP synthase components as well, providing additional targets for intervention.

What emerging technologies are most promising for studying ATP synthase dynamics in P. syringae during plant infection?

Several cutting-edge technologies show exceptional promise for studying ATP synthase dynamics in P. syringae during plant infection:

  • Advanced In Situ Imaging:

    • Cryo-electron tomography (cryo-ET) of bacteria inside plant tissues

    • Super-resolution microscopy with genetically encoded fluorescent ATP synthase components

    • Single-molecule tracking to monitor ATP synthase dynamics during infection

    • Expansion microscopy to visualize bacterial structures within plant tissues at enhanced resolution

  • Real-time Metabolic Sensors:

    • Genetically encoded FRET-based ATP sensors incorporated into P. syringae

    • NAD(P)H autofluorescence for real-time redox state monitoring

    • Membrane potential sensors to track PMF during host interaction

    • pH-sensitive fluorescent proteins to monitor intracellular and periplasmic pH

  • Single-cell Transcriptomics and Proteomics:

    • Bacterial single-cell RNA-seq during different infection stages

    • Spatial transcriptomics to correlate bacterial gene expression with plant tissue location

    • Single-cell proteomics to monitor ATP synthase protein levels at individual cell resolution

    • Proximity labeling (BioID, APEX) to identify proteins interacting with ATP synthase in vivo

  • Microfluidic Approaches:

    • Plant-on-a-chip systems for controlled bacterial-plant interactions

    • Microfluidic techniques to isolate bacteria from infected tissue with minimal disruption

    • Gradient generators to study bacterial responses to changing microenvironments

    • Real-time monitoring of single-cell energetics under defined conditions

  • Integration of Multi-omics Data:

    TechnologyApplication to ATP Synthase ResearchKey Advantage
    Spatial metabolomicsMap energy metabolites around infection sitesCorrelates bacterial metabolism with infection stages
    Multi-modal single-cell analysisCorrelate transcription, translation, and activityReveals regulatory dynamics at single-cell level
    Live-cell structural biologyVisualize ATP synthase conformational changesProvides structural context for functional changes
    AI-driven image analysisAutomated tracking of ATP synthase dynamicsEnables processing of large imaging datasets

Recent advances in understanding bacterial transcriptional regulatory networks in P. syringae can be leveraged to integrate ATP synthase regulation within the broader context of metabolic adaptation during infection. Additionally, studies of bacterial-phage interactions in P. syringae demonstrate how selection pressures can drive rapid evolution of bacterial surface components, potentially including those that influence membrane organization and, by extension, ATP synthase function.

The discovery of ATP synthases with novel architectures in photosynthetic bacteria highlights the importance of applying cutting-edge structural biology techniques to P. syringae ATP synthase to uncover potential unique features that might influence its function during plant infection.

How does P. syringae pv. phaseolicola ATP synthase function interact with host plant energy metabolism during infection?

The interaction between P. syringae pv. phaseolicola ATP synthase function and host plant energy metabolism represents a complex relationship that influences infection outcomes:

  • Competition for Resources:

    • Bacterial ATP synthase enables P. syringae to efficiently utilize available resources in the apoplast

    • Plant hosts respond to infection by altering their own energy metabolism, creating a competitive dynamic

    • Transcriptomic studies have shown that plants reallocate energy resources toward defense responses, while bacteria upregulate metabolic genes to sustain growth in this challenging environment

  • Impact on Plant Mitochondrial and Chloroplast Function:

    • P. syringae effectors and toxins can disrupt plant organellar function

    • Phaseolotoxin inhibits ornithine carbamoyltransferase in the arginine biosynthetic pathway, creating a metabolic drain that affects plant energy status

    • Bacterial growth in the apoplast can create localized energy sinks that alter plant source-sink relationships

  • PMF Manipulation:

    • Both plant and bacterial cells maintain proton gradients across membranes for energy production

    • Certain bacterial effectors may target components that maintain these gradients

    • ATP synthase function in both organisms depends on these gradients, creating potential for interference

  • Integrated Metabolic Responses:

    Bacterial ResponseHost Plant ResponseNet Effect on Energy Dynamics
    Upregulation of ATP synthaseIncreased respiratory activity for defenseCompetition for oxygen and resources
    Secretion of phaseolotoxinArginine depletion and metabolic disruptionReduced host energy availability
    Biofilm formationCallose deposition and barrier formationAltered microenvironment with resource limitations
    Effector-mediated suppression of defensesActivated immunity in unaffected tissuesSpatial variation in energy allocation
  • Regulatory Network Integration:

    • Bacterial sensing of plant metabolic status may influence ATP synthase regulation

    • Transcriptional profiling reveals that exposure to plant extracts triggers significant changes in bacterial gene expression, including genes involved in energy production

    • The genome-wide transcriptional regulatory network of P. syringae includes numerous master regulators that control metabolic pathways, suggesting sophisticated integration between energy production and virulence factor expression

Understanding these interactions provides insights into how bacterial energy production contributes to successful infection and identifies potential intervention points. The study of ATP synthase in this context reveals not just a housekeeping function but a key component in the pathogen's adaptive response to the host environment.

What role does ATP synthase play in P. syringae pv. phaseolicola survival under plant immune responses?

ATP synthase plays a critical role in P. syringae pv. phaseolicola survival when facing plant immune responses, contributing to bacterial persistence through several mechanisms:

  • Adaptation to Oxidative Stress:

    • Plant immune responses generate reactive oxygen species (ROS)

    • ATP synthase function is essential for powering ROS detoxification systems

    • Energy-dependent repair of oxidative damage requires efficient ATP production

    • Transcriptional profiling shows coordinated upregulation of ATP synthase components and oxidative stress response genes when bacteria encounter plant defense compounds

  • Nutrient Limitation Responses:

    • Plant immunity includes nutrient withholding strategies (nutritional immunity)

    • ATP synthase efficiency becomes crucial under nutrient-limited conditions

    • Energy conservation and efficient ATP production enable survival during extended periods of limitation

    • Bacterial siderophore production, which counters iron limitation strategies, requires substantial energy input

  • pH Homeostasis in Changing Environments:

    • Plant defense responses include apoplastic pH changes

    • ATP synthase contributes to bacterial pH homeostasis through PMF maintenance

    • Ability to maintain energy production across pH ranges determines bacterial fitness

  • Support for Virulence Factor Production:

    Immune ResponseEnergy RequirementATP Synthase Contribution
    ROS burstHigh ATP demand for detoxificationPowers antioxidant systems and repair mechanisms
    Antimicrobial compoundsIncreased energy for efflux pumpsMaintains PMF for efficient efflux pump function
    Nutrient restrictionATP conservation crucialMaximizes energy yield from limited resources
    PR protein productionEnergy for countering PR proteinsPowers synthesis of degradative enzymes
  • Effector Delivery and Function:

    • Type III secretion system operation requires substantial energy input

    • ATP synthase provides energy for effector translocation into host cells

    • Continued effector production throughout infection depends on sustained ATP availability

    • Studies of HopZ3 and other effectors demonstrate the energy-intensive nature of effector-mediated immune suppression

  • Coordination with Stress Responses:

    • ATP synthase expression appears coordinated with stress response pathways

    • The genome-wide transcriptional regulatory network in P. syringae shows integration between metabolic regulators and stress response pathways

    • Energy production and allocation shift dynamically in response to changing defense environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.