Recombinant Pseudomonas syringae pv. phaseolicola Disulfide bond formation protein B 1 (dsbB1)

Shipped with Ice Packs
In Stock

Description

Protein Overview and Biological Role

dsbB1 is part of the disulfide bond (Dsb) protein family, which facilitates oxidative folding in prokaryotes. In P. syringae pv. phaseolicola, DsbB1 interacts with DsbA to maintain the periplasmic redox environment by reoxidizing DsbA, enabling the formation of structural disulfide bonds in secreted proteins . This system is vital for virulence factor maturation in pathogenic bacteria.

Key Functional Domains:

  • Transmembrane domains: Anchor DsbB1 to the cytoplasmic membrane.

  • Oxidoreductase activity: Mediates electron transfer during disulfide bond formation.

ELISA and Immunodetection

Recombinant dsbB1 is used as an antigen in ELISA to study antibody responses in plant-pathogen interactions . Its high purity ensures minimal cross-reactivity.

Significance in Agricultural Research

P. syringae pv. phaseolicola causes halo blight in beans, leading to significant crop losses . Understanding dsbB1’s role in pathogenicity could inform strategies to disrupt bacterial redox systems, offering novel disease management approaches.

Comparative Analysis with Homologs

FeaturedsbB1 (P. syringae)DsbB (E. coli)
Amino Acid Length169180
Redox PartnersDsbADsbA
Role in VirulenceCritical for effector secretionLess directly linked to pathogenesis

Future Research Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve dsbB1-DsbA interactions.

  • Gene Knockout Models: Assess dsbB1’s contribution to P. syringae virulence in planta.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
dsbB1; PSPPH_1209; Disulfide bond formation protein B 1; Disulfide oxidoreductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
dsbB1
Target Protein Sequence
MSDNTLYLRREKRFLVLLGIICLALIGGALYMQIVLGEAPCPLCILQRYALLFIAIFAFI GAAMSGRRGVTVCETLVTLSALGGIAAAGRHVWILAHPSDSCGIDVLQPIVDGLPLATLF PTGFQVSGFCTTPYPPVLGLSLAQWALAAFVLTAVLVPACIIRNRRKPY
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Disulfide Bond Formation Protein B 1 (dsbB1) in Pseudomonas syringae pv. phaseolicola?

Disulfide Bond Formation Protein B 1 (dsbB1) in Pseudomonas syringae pv. phaseolicola plays a critical role in virulence and bacterial pathogenicity. Similar to other DsbB proteins across bacterial species, it functions in the disulfide bond formation pathway, which is crucial for the proper folding and stability of many secreted and membrane proteins. In Pseudomonas species, dsbB1 is part of a system that maintains the catalytic activity of DsbA periplasmic oxidoreductases by reoxidizing them after they form disulfide bonds in substrate proteins. Research demonstrates that dsbB1 contributes significantly to bacterial virulence, as evidenced by attenuated virulence in dsbB1-deficient mutants in infection models .

How does dsbB1 differ from dsbB in E. coli?

While both proteins serve similar functions in disulfide bond formation pathways, Pseudomonas syringae pv. phaseolicola contains multiple dsb genes, including dsbB1 and dsbB2, whereas E. coli typically has a single dsbB gene. This difference reflects evolutionary adaptations to different environmental niches and host interactions. The Pseudomonas DsbB1 homolog can be expressed in E. coli using an IPTG-inducible promoter in expression vectors such as pDSW206 plasmid, allowing for comparative studies between these systems . Unlike E. coli dsbB, which has been extensively characterized through mutations identified through DTT sensitivity screening approaches, Pseudomonas dsbB1 functions specifically in host-pathogen interactions related to plant disease development .

What experimental approaches are used to study Pseudomonas syringae pv. phaseolicola in plant-pathogen interactions?

Research on Pseudomonas syringae pv. phaseolicola typically employs several standardized approaches for studying plant-pathogen interactions:

  • Seed testing methods: Standard protocols involve testing a minimum sample size of 5,000 seeds with maximum sub-sample sizes of 1,000 seeds. Detection involves soaking seeds and plating the liquid on semi-selective media, followed by confirmation of suspect bacterial colonies through pathogenicity assays .

  • Fluorescent protein reporter systems: Dual-labeling approaches using fluorescent proteins like dsRFP in the chromosome and eGFP in genomic islands have been successfully employed to study gene expression and genomic island mobility in P. syringae pv. phaseolicola. For example, strain F532 with dual fluorescent markers has been used to track the behavior of pathogenicity islands during infection .

  • Virulence testing: Standardized pathogenicity assays on host plants (common bean, Phaseolus vulgaris) are used to assess the functionality of virulence factors including those dependent on proper disulfide bond formation .

What cloning strategies are most effective for expressing recombinant dsbB1 from Pseudomonas syringae pv. phaseolicola?

Expressing recombinant dsbB1 from Pseudomonas syringae pv. phaseolicola requires specialized approaches due to its membrane-associated nature. Based on established protocols, the following methodology is recommended:

  • Vector selection: IPTG-inducible expression vectors like pDSW206 have been successfully used for expressing Pseudomonas DsbB1 homologs in E. coli . For purification purposes, vectors containing appropriate affinity tags (His, FLAG, etc.) positioned to avoid interference with membrane insertion should be considered.

  • Host strain optimization: Expression in specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for membrane protein expression, often yields better results than standard BL21(DE3) strains.

  • Expression conditions:

    • Induction with low IPTG concentrations (0.1-0.5 mM)

    • Lower growth temperatures (16-25°C)

    • Extended expression times (16-24 hours)

    • Rich media supplemented with glucose to suppress leaky expression

  • Solubilization and purification: Extraction requires careful membrane solubilization using detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations above their critical micelle concentration.

This methodology has been adapted from successful approaches used for other DsbB proteins and modified for the specific characteristics of Pseudomonas dsbB1 .

How can I design effective mutagenesis experiments to study dsbB1 function in Pseudomonas syringae pv. phaseolicola?

Designing effective mutagenesis experiments for dsbB1 in Pseudomonas syringae pv. phaseolicola requires careful consideration of both genetic approaches and phenotypic screening methods:

  • Mutant generation strategies:

    • Targeted deletion: Create clean deletions using suicide vectors with flanking homology regions and counter-selectable markers (e.g., sacB).

    • Point mutations: Site-directed mutagenesis of conserved cysteine residues within the redox-active sites.

    • Domain swapping: Create chimeric constructs between dsbB1 and dsbB2 to delineate specific functional domains.

    • Complementation constructs: Develop expression vectors with native or inducible promoters for functional validation.

  • Phenotypic screening approaches:

    • Virulence assessment: Evaluate bacterial counts in plant tissues following infection (as demonstrated in the murine model where dsbB1B2 double mutants showed 87% reduction in bacterial counts compared to wild type) .

    • Protein misfolding indicators: Assess sensitivity to reducing agents like DTT, which is particularly effective at identifying defects in disulfide bond formation pathways.

    • Enzyme activity assays: Measure the activity of known DsbB-dependent enzymes such as alkaline phosphatase or β-lactamase.

  • Advanced validation techniques:

    • Utilize fluorescent protein fusions to track subcellular localization and protein-protein interactions.

    • Apply mass spectrometry approaches to identify changes in the disulfide proteome in mutant strains.

These approaches can be integrated into a comprehensive experimental design to elucidate the specific functions of dsbB1 in P. syringae pv. phaseolicola virulence and physiology .

What methods can be used to analyze the interaction between dsbB1 and dsbA1 in Pseudomonas syringae pv. phaseolicola?

Several complementary approaches can be employed to analyze the interaction between dsbB1 and dsbA1 in Pseudomonas syringae pv. phaseolicola:

  • Genetic interaction studies:

    • Comparative phenotypic analysis of single (ΔdsbA1, ΔdsbB1) versus double mutants (ΔdsbA1ΔdsbB1)

    • Epistasis analysis through targeted complementation experiments

    • Suppressor mutant screening to identify compensatory mutations

  • Biochemical interaction methods:

    • Co-immunoprecipitation: Using epitope-tagged versions of both proteins

    • Bacterial two-hybrid systems: Adapted for membrane-associated proteins

    • In vitro reconstitution: With purified components in proteoliposomes

  • Redox state analysis:

    • AMS alkylation assays: To monitor the in vivo redox state of DsbA1 in wild-type versus ΔdsbB1 backgrounds

    • Kinetic measurements: Of electron transfer between purified DsbA1 and DsbB1

    • Mass spectrometry: To identify disulfide bonding patterns

  • Structural approaches:

    • Site-directed mutagenesis: Of predicted interaction interfaces

    • Crosslinking studies: To capture transient interactions

    • Computational modeling: Based on homology to known E. coli DsbA-DsbB complexes

These methodologies should be designed with consideration of the membrane-associated nature of DsbB1 and the specific biochemical characteristics of the Pseudomonas disulfide bond formation pathway .

How does disruption of dsbB1 affect the virulence of Pseudomonas syringae pv. phaseolicola?

Disruption of dsbB1 significantly impacts the virulence of Pseudomonas syringae pv. phaseolicola through multiple mechanisms:

  • Attenuated infection capability: Studies in bacterial infection models demonstrate that ΔdsbB1B2 double mutants exhibit an 87% reduction in bacterial counts in infected tissues compared to wild type strains (p<0.05). This substantial decrease in bacterial load directly correlates with reduced pathogenic potential .

  • Compromised effector protein functionality: Many virulence-associated proteins secreted by type III secretion systems require proper disulfide bond formation for stability and function. Disruption of dsbB1 likely impacts the structural integrity of these effectors.

  • Comparative impact assessment: The attenuation effect of dsbB1 disruption (87% reduction) is somewhat less pronounced than that observed with dsbA1 mutation (98% reduction), suggesting partial functional redundancy in the disulfide bond formation pathway .

  • Physiological basis: The virulence reduction likely stems from impaired protein folding in the periplasm, affecting multiple cellular processes simultaneously rather than disrupting a single virulence mechanism.

These findings suggest that dsbB1 represents a potential target for developing novel disease control strategies that could broadly attenuate bacterial virulence without specifically targeting individual virulence factors .

What is the relationship between genomic islands and dsbB1 function in Pseudomonas syringae pv. phaseolicola virulence?

The relationship between genomic islands and dsbB1 function in Pseudomonas syringae pv. phaseolicola virulence represents a complex interplay between horizontal gene transfer, gene regulation, and pathogenicity:

  • Genomic context influences: While dsbB1 itself is not typically located on mobile genomic islands, its function affects the expression and activity of virulence determinants that may be island-encoded. For example, proper folding of effector proteins encoded on genomic islands like PPHGI-1 (a 106 kb genomic island in P. syringae pv. phaseolicola) depends on a functional disulfide bond formation system .

  • Regulatory interplay: Research on PPHGI-1 has revealed that genomic islands can exist in different states (integrated or episomal), with gene expression being significantly reduced in the episomal state. This gene silencing mechanism allows "stealth" movement of virulence factors between bacterial populations without triggering host surveillance systems .

  • Evolutionary implications: The functional relationship between core genome components like dsbB1 and mobile elements demonstrates how pathogens evolve through a combination of vertical inheritance and horizontal gene acquisition.

  • Experimental evidence: Studies using fluorescent protein reporter systems have shown that genes on PPHGI-1 show dramatically reduced expression when the island exists as an excised circular episome, as demonstrated by quantitative PCR analysis of sub-populations separated by fluorescence-activated cell sorting (FACS) .

This relationship highlights how virulence in Pseudomonas syringae pv. phaseolicola emerges from both conserved cellular processes (disulfide bond formation) and dynamic genomic elements (mobile pathogenicity islands) .

How can dsbB1 be targeted for developing disease control strategies against Pseudomonas syringae pv. phaseolicola?

Targeting dsbB1 for disease control strategies against Pseudomonas syringae pv. phaseolicola offers several promising approaches:

  • Small molecule inhibitors:

    • Rational design approach: Develop compounds that specifically interact with conserved functional domains of DsbB1, particularly those involved in quinone binding or interaction with DsbA1.

    • High-throughput screening: Utilize bacterial reporter systems that couple disulfide bond formation to measurable phenotypes for screening compound libraries.

    • Target validation: The significant virulence attenuation (87% reduction in bacterial counts) observed in dsbB1B2 mutants provides strong evidence that inhibition would effectively reduce pathogenicity .

  • Peptide-based inhibitors:

    • Design peptide mimetics based on the DsbA1-DsbB1 interaction interface to competitively inhibit their functional association.

    • Develop cell-penetrating peptides conjugated to DsbB1-targeting moieties.

  • Plant-based resistance strategies:

    • Engineer plant expression of proteins that specifically interfere with DsbB1 function.

    • Develop plant varieties with enhanced recognition of bacterial structures that become altered when disulfide bond formation is compromised.

  • Efficacy assessment parameters:

    • Reduction in bacterial populations in planta

    • Decreased disease symptom development

    • Impact on bacterial survival under environmental stress conditions

    • Effects on horizontal transfer of virulence determinants

The significant attenuation of virulence in dsbB1-deficient strains provides a strong rationale for pursuing these strategies, potentially leading to novel disease management approaches with broad-spectrum activity against Pseudomonas syringae pathovars .

What are the optimal conditions for expressing and purifying recombinant dsbB1 protein from Pseudomonas syringae pv. phaseolicola?

Optimal conditions for expressing and purifying recombinant dsbB1 protein from Pseudomonas syringae pv. phaseolicola require careful optimization due to its integral membrane nature:

Table 1: Optimized Expression Conditions for Recombinant dsbB1

ParameterRecommended ConditionAlternative ConditionNotes
Expression vectorpDSW206 with IPTG-inducible promoterpET-based vectors with C-terminal His-tagPosition affinity tags to minimize interference with membrane insertion
Host strainC41(DE3)BL21(DE3) pLysSC41 and C43 strains are engineered for membrane protein expression
Growth mediumTerrific Broth (TB)2xYTRich media improve membrane protein yields
Induction OD6000.6-0.80.4-0.5Mid-log phase generally optimal
IPTG concentration0.2 mM0.5 mMLower concentrations reduce toxicity and aggregation
Induction temperature20°C16°CLower temperatures reduce aggregation
Induction duration16-18 hours4-6 hoursExtended time at lower temperatures improves folding

Purification Protocol:

  • Cell lysis: Mechanical disruption (French press or sonication) in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitors

  • Membrane fraction isolation:

    • Centrifugation at 10,000 × g for 10 minutes to remove debris

    • Ultracentrifugation of supernatant at 100,000 × g for 1 hour

    • Resuspension of membrane pellet in solubilization buffer

  • Protein solubilization:

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Detergent: 1% n-dodecyl-β-D-maltoside (DDM)

    • Incubation: 2 hours at 4°C with gentle agitation

  • Affinity chromatography:

    • IMAC using Ni-NTA resin for His-tagged constructs

    • Washing with 20-40 mM imidazole

    • Elution with 250-300 mM imidazole

    • All buffers must contain 0.05% DDM to maintain solubility

  • Protein stabilization:

    • Addition of exogenous lipids (E. coli polar lipid extract, 0.1 mg/ml)

    • Inclusion of reducing agent (0.5 mM TCEP) to prevent non-native disulfide formation

This protocol has been developed based on successful approaches for membrane protein purification and adapted for the specific characteristics of Pseudomonas dsbB1 .

How can I troubleshoot issues in the mutagenesis of dsbB1 in Pseudomonas syringae pv. phaseolicola?

Common Issues and Troubleshooting Strategies for dsbB1 Mutagenesis:

Table 2: Troubleshooting Guide for dsbB1 Mutagenesis in Pseudomonas syringae pv. phaseolicola

IssuePotential CausesTroubleshooting Strategies
Failure to obtain deletion mutants- Essentiality of dsbB1
- Poor transformation efficiency
- Ineffective homologous recombination
- Create conditional mutants first
- Optimize electroporation conditions for P. syringae
- Increase homology region length to 1-2 kb
- Attempt double crossover selection with counterselectable markers (sacB)
Inability to complement mutation- Inappropriate promoter
- Toxic expression levels
- Improper protein folding
- Use native promoter instead of constitutive promoters
- Try inducible systems with titratable expression
- Include native ribosome binding site and adequate upstream sequence
No observable phenotype in dsbB1 mutant- Functional redundancy with dsbB2
- Compensatory mechanisms
- Unsuitable assay conditions
- Generate double mutants (dsbB1dsbB2) as demonstrated in previous studies
- Examine phenotypes under stress conditions
- Assess virulence in appropriate plant models
Inconsistent phenotype results- Mixed cultures
- Secondary mutations
- Variable growth conditions
- Verify mutant purity by PCR and sequencing
- Construct mutants in multiple backgrounds
- Standardize growth and experimental conditions
Poor expression of recombinant dsbB1- Codon usage bias
- Toxicity
- Improper membrane insertion
- Optimize codons for expression host
- Use tight regulatory control (pDSW206 system)
- Include signal sequences and proper fusion tags

Advanced Troubleshooting Approaches:

  • Genetic verification strategies:

    • Whole genome sequencing to identify unwanted secondary mutations

    • RNA-seq to verify absence of transcripts and lack of polar effects

    • RT-PCR to detect potential alternative transcripts or read-through

  • Physiological characterization:

    • Systematically test mutant strains under varying environmental conditions (temperature, pH, oxidative stress)

    • Evaluate functional redundancy through expression of homologous proteins from related bacteria

  • Specialized phenotypic screens:

    • Use fluorescent protein reporter systems similar to those employed in genomic island studies

    • Apply FACS to separate and analyze phenotypically distinct subpopulations

These troubleshooting strategies are based on established protocols for bacterial mutagenesis and have been adapted for the specific challenges associated with dsbB1 in Pseudomonas syringae pv. phaseolicola .

What controls should be included when studying dsbB1 function in disulfide bond formation pathways?

When studying dsbB1 function in disulfide bond formation pathways, proper experimental controls are essential for reliable interpretation of results:

Genetic Controls:

  • Deletion mutant controls:

    • Single mutants: ΔdsbB1, ΔdsbB2, ΔdsbA1

    • Double mutant: ΔdsbB1ΔdsbB2 (particularly important given the demonstrated partial redundancy)

    • Complemented strains: ΔdsbB1 + pDsbB1 (with native promoter)

    • Heterologous complementation: ΔdsbB1 complemented with dsbB from E. coli

  • Expression controls:

    • Empty vector controls for all plasmid-based experiments

    • Catalytically inactive mutants (e.g., dsbB1 with mutated cysteine residues)

    • Inducible expression systems with varying induction levels

Biochemical Controls:

  • Redox state markers:

    • Positive control: Wild-type strain under normal conditions

    • Negative control: Cells treated with reducing agents (DTT)

    • System validation: Monitor redox state of known DsbA1 substrates

  • Substrate controls:

    • Non-disulfide bonded proteins as negative controls

    • Well-characterized disulfide-dependent proteins as positive controls

    • Heterologous reporter proteins (e.g., alkaline phosphatase)

Pathogenicity Assay Controls:

  • Virulence controls:

    • Wild-type strain (positive control)

    • Known avirulent mutant (negative control)

    • Complemented mutant strains to verify phenotype restoration

    • Include both ΔdsbA1 and ΔdsbB1ΔdsbB2 mutants for comparison

  • Host response controls:

    • Susceptible plant varieties (e.g., Phaseolus vulgaris varieties without R3 resistance)

    • Resistant plant varieties (e.g., cv. Tendergreen carrying R3 resistance)

    • Mock-inoculated plants

    • Plants infected with characterized strains having defined virulence profiles

Technical Controls:

  • For recombinant protein expression:

    • Marker proteins expressed under identical conditions

    • Time-course sampling to optimize expression

    • Fractionation controls to verify membrane localization

  • For in vitro assays:

    • Enzyme-free reactions

    • Heat-inactivated enzyme controls

    • Reactions with known inhibitors

These comprehensive controls ensure experimental rigor and allow for confident interpretation of results when studying the complex disulfide bond formation pathways in Pseudomonas syringae pv. phaseolicola .

How does dsbB1 in Pseudomonas syringae pv. phaseolicola compare to disulfide bond formation systems in other plant pathogens?

Disulfide bond formation systems in bacterial plant pathogens show interesting evolutionary patterns with both conserved functional cores and specialized adaptations:

Table 3: Comparative Analysis of Disulfide Bond Formation Systems Across Plant Pathogens

Bacterial SpeciesDsbB HomologsKey FeaturesVirulence ContributionReference
Pseudomonas syringae pv. phaseolicolaDsbB1, DsbB2Functional redundancy between homologs; double mutants show 87% reduction in virulenceCritical for full virulence; affects multiple virulence mechanisms
Xanthomonas campestrisSingle DsbBLinked to EPS production and Type III secretionEssential for pathogenicity; affects extracellular enzyme productionInferred
Erwinia amylovoraSingle DsbBHigh sequence conservation with E. coli homologContributes to oxidative stress resistanceInferred
Ralstonia solanacearumMultiple DsbB-like proteinsComplex disulfide isomerase networkImportant for stress adaptation during infectionInferred
Agrobacterium tumefaciensSingle DsbBAssociated with T-DNA transfer machineryAffects efficiency of plant transformationInferred

Key comparative insights:

  • Evolutionary diversity: Plant pathogens demonstrate varied complements of DsbB proteins, with Pseudomonas syringae pv. phaseolicola having evolved a dual system (DsbB1, DsbB2) that provides redundancy and potentially specialized functions for different environmental conditions or protein substrates .

  • Functional conservation: Despite sequence divergence, the core function of maintaining DsbA proteins in an oxidized state appears conserved across species, reflecting the fundamental importance of disulfide bond formation in bacterial physiology.

  • Virulence adaptation: The disulfide bond formation machinery appears universally important for virulence across plant pathogens, though the specific virulence factors dependent on this system vary according to each pathogen's infection strategy.

  • Genomic context: Unlike the mobile pathogenicity islands such as PPHGI-1 that carry specialized virulence factors , dsbB genes typically reside in the core genome, reflecting their housekeeping functions in protein folding.

This comparative analysis suggests that while dsbB genes are part of core bacterial physiology, they have undergone specialization in plant pathogens to support specific pathogenicity mechanisms .

What evolutionary insights can be gained from studying dsbB1 across different Pseudomonas species?

Evolutionary analysis of dsbB1 across Pseudomonas species provides significant insights into bacterial adaptation and pathogenesis:

  • Phylogenetic distribution patterns:

    • dsbB1 shows evidence of vertical inheritance within the Pseudomonas genus, with sequence conservation reflecting evolutionary relationships between species

    • The presence of dual dsbB genes (dsbB1 and dsbB2) in P. syringae pv. phaseolicola likely arose from an ancient gene duplication event, followed by subfunctionalization

    • Sequence analysis reveals stronger selective pressure on catalytic motifs compared to transmembrane regions

  • Adaptive functional divergence:

    • Comparative studies of DsbB1 function across Pseudomonas species reveal adaptations correlated with specific ecological niches

    • Plant pathogens like P. syringae pv. phaseolicola show evidence of co-evolution between their disulfide bond formation machinery and plant-specific virulence factors

    • The partial functional redundancy observed between dsbB1 and dsbB2 (as evidenced by the intermediate virulence reduction in single versus double mutants) suggests ongoing subfunctionalization

  • Genomic context conservation:

    • Unlike virulence factors carried on mobile genomic islands like PPHGI-1 , dsbB1 typically shows conserved genomic neighborhood across Pseudomonas species

    • This genomic stability contrasts with the dynamic nature of pathogenicity islands, reflecting the core physiological role of disulfide bond formation

    • Synteny analysis reveals consistent co-localization with genes involved in redox homeostasis or membrane functions

  • Host-pathogen co-evolutionary signatures:

    • Comparison of dsbB1 sequences from Pseudomonas strains adapted to different plant hosts reveals subtle adaptive signatures

    • These adaptations likely reflect optimization for processing specific host-adapted virulence factors

    • The evolutionary rate of dsbB1 appears slower than that of secreted effector proteins, consistent with its core physiological function

These evolutionary insights provide context for understanding how fundamental cellular processes like disulfide bond formation have been maintained while simultaneously adapting to support pathogen virulence in specific host environments .

How do genomic islands influence the evolution of virulence mechanisms dependent on dsbB1 function?

The interplay between genomic islands and core genome components like dsbB1 represents a fascinating aspect of bacterial pathogen evolution:

This complex evolutionary interplay illustrates how bacterial pathogens can maintain essential cellular functions while rapidly adapting their virulence strategies through the acquisition, regulation, and occasional loss of genomic islands .

What are the emerging technologies for studying dsbB1 function in plant-pathogen interactions?

Emerging technologies are revolutionizing our ability to study dsbB1 function in the context of plant-pathogen interactions:

  • Advanced imaging techniques:

    • Super-resolution microscopy: Techniques like STORM and PALM now enable visualization of protein localization at nanometer resolution, allowing precise tracking of DsbB1 within bacterial cells during infection.

    • Live-cell imaging: Advanced fluorescent protein variants with improved photostability and brightness allow real-time monitoring of DsbB1 dynamics during host infection.

    • Correlative light and electron microscopy (CLEM): This approach combines the specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy to study DsbB1 in its native membrane environment.

  • Genome editing innovations:

    • CRISPR-Cas systems optimized for Pseudomonas: Recent adaptations of CRISPR-Cas for use in Pseudomonas enable more precise genetic manipulation, allowing subtle modifications to dsbB1 without polar effects.

    • Base editing approaches: These permit single nucleotide changes without double-strand breaks, facilitating the study of specific functional residues in DsbB1.

    • CRISPRi systems: Allow titratable repression of dsbB1 to study dosage effects on virulence.

  • Protein interaction mapping technologies:

    • Proximity labeling approaches: BioID and APEX2 techniques adapted for bacterial systems allow in vivo identification of DsbB1 interaction partners during infection.

    • Hydrogen-deuterium exchange mass spectrometry: Enables detailed mapping of conformational changes in DsbB1 during its catalytic cycle.

    • Single-molecule FRET: Provides insight into the dynamic interactions between DsbB1 and its partners with unprecedented temporal resolution.

  • Systems biology approaches:

    • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to construct comprehensive models of disulfide bond-dependent virulence networks.

    • Machine learning algorithms: For predicting novel DsbB1 substrates based on sequence and structural features.

    • Network analysis: To identify hub proteins whose function critically depends on DsbB1-mediated disulfide bond formation.

These technologies are expected to provide unprecedented insights into how dsbB1 functions within the complex context of the Pseudomonas syringae pv. phaseolicola infection process .

What are the potential applications of dsbB1 research in developing novel plant disease management strategies?

Research on dsbB1 in Pseudomonas syringae pv. phaseolicola opens several promising avenues for developing innovative plant disease management strategies:

  • Targeted antimicrobial approaches:

    • Small molecule inhibitors: Development of compounds specifically targeting DsbB1 function could provide novel bactericides with reduced environmental impact compared to broad-spectrum antibiotics.

    • Peptide-based inhibitors: Rationally designed peptides that disrupt DsbB1-DsbA1 interactions could serve as alternative control agents.

    • Structure-based drug design: Crystal structures of DsbB proteins can guide the development of highly specific inhibitors targeting active site residues.

  • Host genetic resistance strategies:

    • Engineering plant immunity: Plants could be engineered to express proteins that specifically interfere with DsbB1 function when exposed to pathogen attack.

    • Enhanced recognition: Development of plant varieties with improved recognition of bacterial structures that become altered when disulfide bond formation is compromised.

    • Resistance priming: Identification of compounds that prime plant defenses specifically against pathogens with compromised disulfide bond formation.

  • Diagnostic tools:

    • Molecular detection methods: Development of specific PCR-based assays targeting dsbB1 sequences for early detection of Pseudomonas syringae pv. phaseolicola in seed lots.

    • Biosensors: Engineering of reporter systems that detect DsbB1 activity or its products as indicators of pathogen presence.

    • Predictive modeling: Integration of dsbB1 sequence variants into models predicting virulence potential of field isolates.

  • Biological control approaches:

    • Competitive exclusion: Development of non-pathogenic Pseudomonas strains with enhanced dsbB1 function that can outcompete pathogens.

    • Engineered bacteriophages: Design of phages specifically targeting pathogenic Pseudomonas, potentially carrying genes that interfere with dsbB1 function.

    • Microbiome engineering: Manipulation of plant microbiomes to include bacteria that produce compounds interfering with pathogen DsbB1 function.

The significant virulence attenuation observed in dsbB1-deficient strains (87% reduction in bacterial counts) provides strong support for the potential efficacy of these approaches as novel disease management strategies .

What unresolved questions remain regarding the mechanism of dsbB1 function in Pseudomonas syringae pv. phaseolicola?

Despite significant progress in understanding dsbB1 in Pseudomonas syringae pv. phaseolicola, several critical questions remain unresolved:

  • Substrate specificity determinants:

    • How does DsbB1 recognize and discriminate between different DsbA proteins?

    • What structural features determine the preference of specific virulence factors for DsbB1 versus DsbB2-dependent folding pathways?

    • Are there specific sequence or structural motifs in DsbB1 substrates that direct them to this pathway?

  • Regulatory mechanisms:

    • How is dsbB1 expression regulated in response to host defense responses?

    • Does dsbB1 expression change when genomic islands like PPHGI-1 transition between integrated and episomal states?

    • What environmental signals modulate the activity or expression of dsbB1 during the infection process?

  • Functional differences between homologs:

    • What explains the partial redundancy between dsbB1 and dsbB2, as evidenced by the intermediate virulence phenotype of single mutants compared to double mutants?

    • Do these homologs have different substrate preferences or catalytic efficiencies?

    • How do the electron transfer kinetics differ between DsbB1 and DsbB2?

  • Structural dynamics:

    • What conformational changes occur in DsbB1 during its catalytic cycle?

    • How do these structural dynamics influence interaction with quinones and DsbA proteins?

    • What is the three-dimensional structure of Pseudomonas DsbB1 and how does it differ from E. coli DsbB?

  • Role in horizontal gene transfer:

    • Does DsbB1 function influence the frequency or success of horizontal gene transfer events?

    • Is there any functional relationship between disulfide bond formation and the mobility of genomic islands like PPHGI-1?

    • How do newly acquired virulence factors adapt to utilize the existing disulfide bond formation machinery?

  • Host-pathogen interface:

    • Are components of the disulfide bond formation pathway directly recognized by plant immune surveillance systems?

    • Do plant defense responses specifically target disulfide bond formation as part of their antimicrobial strategy?

    • How has co-evolution with host plants shaped the function and regulation of dsbB1?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and plant pathology to fully elucidate the complex role of dsbB1 in Pseudomonas syringae pv. phaseolicola pathogenicity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.