Recombinant Pseudomonas syringae pv. phaseolicola Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; PSPPH_4333; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
mscL
Target Protein Sequence
MSVLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPLGLLIGGVDFSDLAIT LRPAQGTAPAVLLAYGKFIQTVIDFIIVAFAIFMGVKAINRLKREEAKAPTLPPTPSKQE VLLSEIRDLLKEQNKPAAPVTVDPTRPL
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MscL and what is its role in bacterial physiology?

MscL (Large-conductance mechanosensitive channel) is a membrane protein that functions as a biological safety valve in bacteria. It responds to mechanical tension in the membrane by opening a large pore that allows rapid efflux of osmolytes, thereby protecting bacteria from lysis during hypoosmotic shock. In bacteria like Pseudomonas syringae pv. phaseolicola, MscL plays a critical role in survival when cells experience sudden decreases in external osmolarity, such as during rainfall or other environmental changes that could otherwise lead to excessive water influx and cell rupture .

How does MscL sense membrane tension?

MscL directly senses membrane tension developed in the lipid bilayer without requiring any second messengers or cytoskeletal tethering. This mechanism follows the force from lipid (FFL) principle, which was first proposed for E. coli MS channels by Martinac et al. (1987). The FFL principle is based on the fact that self-assembled bilayers exert inherent forces that are large and anisotropic, subjecting embedded proteins to push and pull forces. When sufficient membrane tension is applied (approximately 12.0 mN/m for MscL), the channel undergoes conformational changes that lead to its opening .

What are the optimal conditions for reconstituting recombinant MscL in artificial membranes?

For reconstituting recombinant MscL in artificial membranes, researchers should:

  • Purify the recombinant protein to >90% purity as determined by SDS-PAGE

  • Create proteoliposomes with controlled lipid composition (typically phosphatidylcholine and phosphatidylethanolamine at specific ratios)

  • Reconstitute the protein at a protein:lipid ratio of approximately 1:200 to 1:1000

  • Use a buffer system containing 10-20 mM Tris/HEPES (pH 7.2-7.4) with 100-200 mM KCl

  • Avoid repeated freeze-thaw cycles by aliquoting the reconstituted samples

  • Store reconstituted samples with 5-50% glycerol at -20°C/-80°C for optimal stability

This approach allows for direct measurement of channel activity without interference from cytoskeletal elements or other cellular components, providing a well-controlled system to study membrane mechanical properties and channel function .

What electrophysiological techniques are most effective for studying MscL activity?

Patch clamp combined with fast pressure stimulation is the gold standard for studying MscL kinetic properties. Several configurations can be employed:

When studying recombinant MscL, the outside-out configuration is particularly useful for characterizing channel properties. By applying pulses of increasing pressure against the membrane, researchers can determine:

  • Activation threshold

  • Half pressure activation (P₁/₂)

  • Maximum activation pressure

  • Open probability-pressure relationship (typically fits a Boltzmann function)

Complementary techniques include poking and carbon fiber methods that allow application of membrane stretch while recording cellular responses .

How can researchers assess the mechanosensitivity of MscL mutants relative to wild-type channels?

To quantitatively assess mechanosensitivity of MscL mutants compared to wild-type:

  • Use an internal standard approach with MscS as a reference within the same patch

  • Determine the pressure ratio pL/pS (pressure required to open MscL divided by pressure required to open MscS)

  • Lower pL/pS ratios indicate channels that gate at lower tensions and thus have increased mechanosensitivity

  • Standardize data using this approach to account for differences in patch geometry according to Laplace's law (tension is a function of both pressure and radius of curvature)

This methodology enables reliable comparisons between different channel variants regardless of absolute pressure variations due to patch-specific factors. For example, chimeras with different residues in the TM2 region (amino acids 98-106) have demonstrated significantly different mechanosensitivity when assessed using this approach .

How can researchers generate gain-of-function (GOF) or loss-of-function (LOF) MscL mutants for specific research purposes?

Researchers can generate GOF or LOF MscL mutants through several strategic approaches:

  • Random Mutagenesis:

    • Employ error-prone PCR or chemical mutagenesis

    • Screen for altered phenotypes in bacteria under osmotic challenge

    • Early studies identified GOF mutations that were predominantly hydrophilic substitutions in the first transmembrane helix (TM1)

  • Site-Directed Mutagenesis:

    • Target specific residues based on structural information

    • For GOF mutants, introduce hydrophilic residues into the pore-lining regions

    • For LOF mutants, modify residues involved in tension sensing or channel opening

  • Chimeric Approaches:

    • Exchange segments between MscL homologs with different sensitivities

    • Focus particularly on the TM2 region (amino acids 98-106) which has been shown to significantly affect channel sensitivity

These mutations provide valuable insights into gating mechanisms and can serve as tools for studying channel function in various contexts .

What are the approaches for modulating MscL channel activity for research applications?

Multiple approaches exist for modulating MscL channel activity:

Modulation ApproachMechanismResearch Applications
Genetic modificationIntroduction of mutations that alter channel propertiesStudying structure-function relationships
Chemical modificationAddition of compounds that interact with specific residuesControlled activation/inactivation studies
Environmental manipulationAltering lipid composition, pH, or ionic conditionsUnderstanding contextual influences on channel behavior
Physical interventionsDirect application of tension using patch clamp or other mechanical methodsReal-time analysis of channel kinetics

Particularly informative are studies using forward genetics approaches that identified mutations leading to increased activation of MscL. Many of these mutations introduced hydrophilic residues in the first transmembrane helix (TM1), highlighting the importance of this region in channel gating .

How do electrostatic interactions influence MscL channel properties?

Electrostatic interactions at the membrane interface play a crucial role in defining MscL channel characteristics and gating behavior. Research has demonstrated:

  • Charges at specific positions can dramatically alter channel sensitivity to membrane tension

  • Mutations that change the electrostatic profile of the protein-lipid interface can lead to GOF or LOF phenotypes

  • The interaction between charged residues and the lipid headgroups contributes to the energy required for conformational changes during gating

Experimental evidence has shown apparently contradictory findings in some cases, suggesting complex relationships between electrostatics and channel function. For instance, mutations in the TM2 region (amino acids 98-106) significantly affect mechanosensitivity, potentially through altered electrostatic interactions with membrane components .

How should researchers interpret open probability-pressure relationships for MscL?

When analyzing open probability-pressure relationships for MscL:

  • Fit the data to a Boltzmann function (sigmoid curve) which represents the relationship between open probability and membrane tension

  • Extract key parameters from the curve:

    • Threshold activation tension (~12.0 mN/m for wild-type MscL)

    • Half-maximal activation pressure (P₁/₂)

    • Slope of the sigmoid (indicates sensitivity to tension changes)

    • Maximum open probability at saturation

  • Compare these parameters between different experimental conditions or mutants to understand changes in channel behavior

  • Consider the following when interpreting results:

    • Steeper slopes indicate higher cooperativity in channel opening

    • Leftward shifts in the curve suggest increased sensitivity to membrane tension

    • Changes in maximum open probability may indicate alterations in channel stability in the open state

How can researchers resolve contradictory findings in MscL studies?

When faced with contradictory findings in MscL research:

  • Examine experimental conditions:

    • Membrane composition differences (lipid type, headgroup chemistry, chain length, saturation)

    • Temperature variations affecting membrane fluidity

    • Ionic conditions that may influence protein-lipid interactions

    • Presence of other cellular components in different preparation methods

  • Consider protein modifications:

    • Effects of tags (His, GST, etc.) on protein conformation or function

    • Post-translational modifications that may differ between expression systems

    • Potential differences in folding between homologs or in different expression systems

  • Employ multiple methodologies:

    • Combine electrophysiological approaches with structural studies

    • Use complementary functional assays (e.g., flux measurements, growth assays)

    • Apply both in vitro and in vivo analyses to validate findings

For example, some studies have shown apparently contradictory electrostatic effects, which may be resolved by careful examination of specific experimental conditions and comprehensive analysis using multiple approaches .

What controls should be included when evaluating recombinant MscL function?

Robust experimental design for evaluating recombinant MscL function should include:

Control TypePurposeImplementation
Positive controlsConfirm assay functionalityInclude well-characterized MscL variants (e.g., E. coli MscL)
Negative controlsEstablish baseline/backgroundUse empty liposomes or inactive mutants
Internal standardsNormalize between experimentsCo-express MscS as reference for relative pressure sensitivity
System-specific controlsAccount for expression system effectsCompare activity in different membrane environments
Technical controlsAssess experimental variationPerform multiple measurements across different protein preparations

Additionally, researchers should validate protein expression and incorporation into membranes using techniques such as Western blotting, fluorescence microscopy (with tagged variants), or mass spectrometry before functional studies. This comprehensive approach ensures reliable and reproducible results when characterizing MscL function .

How does Pseudomonas syringae pv. phaseolicola MscL compare to other bacterial mechanosensitive channels?

Comparing Pseudomonas syringae pv. phaseolicola MscL with other bacterial mechanosensitive channels reveals important functional and structural differences:

ChannelThreshold TensionIon SelectivityMajor Functions
MscL (various bacteria)~12.0 mN/mNon-selectiveEmergency osmotic safety valve
MscS (various bacteria)~6.0 mN/mSlight anion preference (PCl:PK = 1.5-3)Secondary osmotic response
TRP channels (eukaryotes)VariableCation selectiveDiverse sensory functions
TREK channels (mammals)VariableK+ selectiveMembrane potential regulation

Pseudomonas syringae pv. phaseolicola MscL, like other MscL homologs, functions primarily as a non-selective emergency release valve that opens in response to extreme membrane tension. It shares the core principle of direct force sensing from lipids (FFL principle) with other mechanosensitive channels, though its specific amino acid sequence and subtle functional properties may be adapted to the particular environmental pressures faced by this plant pathogen .

What insights can be gained from studying MscL in different bacterial species?

Comparative studies of MscL across different bacterial species provide valuable insights:

  • Evolutionary conservation and adaptation:

    • Core functional domains are highly conserved across species

    • Species-specific variations reflect adaptations to particular ecological niches

    • Differences in sensitivity thresholds correlate with environmental osmotic challenges

  • Structure-function relationships:

    • Variations in channel properties can be mapped to specific sequence differences

    • Chimeric channels combining domains from different species help identify functional regions

    • Correlation between amino acid conservation and functional importance

  • Mechanistic understanding:

    • Universal principles of mechanosensation across diverse bacterial lineages

    • Species-specific regulatory mechanisms that fine-tune channel response

    • Insights into fundamental biophysical principles of membrane-protein interactions

For researchers studying Pseudomonas syringae pv. phaseolicola MscL, comparative approaches with better-characterized homologs (such as E. coli MscL) provide critical context for interpretation of experimental findings and potential applications in research .

What are promising approaches for applying MscL research to synthetic biology applications?

Future applications of MscL research in synthetic biology include:

  • Engineered cell-based biosensors:

    • Development of cells with modified MscL channels that respond to specific mechanical stimuli

    • Coupling MscL activation to reporter gene expression for detecting environmental forces

    • Creation of synthetic circuits that process mechanical information

  • Controlled release systems:

    • Engineered liposomes with MscL channels for stimulus-responsive drug delivery

    • Mechanically triggered release of therapeutic compounds

    • Development of nano-scale devices that respond to physical forces

  • Synthetic cell development:

    • Incorporation of MscL as a core component of minimal cells for osmoregulation

    • Engineering artificial cells with mechanosensing capabilities

    • Using MscL as a model system for understanding fundamental aspects of membrane protein integration

These applications build upon fundamental understanding of the channel's mechanosensitive properties, particularly the knowledge gained from GOF and LOF mutational studies that provide insights into channel gating mechanisms and modulation approaches .

What methodological advances could enhance MscL research?

Several methodological advances could significantly enhance MscL research:

  • Advanced imaging techniques:

    • High-speed atomic force microscopy to visualize conformational changes in real-time

    • Single-molecule FRET to measure dynamic structural transitions during gating

    • Cryo-EM studies of different conformational states

  • Computational approaches:

    • Molecular dynamics simulations of channel-membrane interactions under tension

    • Machine learning applications for predicting effects of mutations

    • Systems biology models integrating MscL function with cellular responses

  • Novel experimental platforms:

    • Microfluidic systems for precise control of mechanical forces

    • Cell-free expression systems combined with artificial membranes

    • High-throughput screening approaches for identifying modulators

These advances would address current limitations in studying the dynamics of channel gating and provide more detailed insights into the molecular mechanisms underlying mechanosensation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.