Recombinant Pseudomonas syringae pv. phaseolicola Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid A-Core Export

MsbA facilitates the asymmetric translocation of lipid A-core (a precursor of lipopolysaccharide, LPS) from the inner to outer leaflet of the bacterial inner membrane. This process is ATP-dependent and critical for:

  • Outer Membrane Stability: Ensures proper LPS assembly and membrane integrity.

  • Pathogenicity: Disruption of MsbA in pathogens like Pseudomonas aeruginosa or Yersinia pestis attenuates virulence .

Mechanistic Insights:

  • Substrate Specificity: MsbA binds lipid A-core with high affinity, distinct from other substrates (e.g., multidrug resistance efflux) .

  • Structural Dynamics: Conformational changes during ATP hydrolysis drive substrate flipping, though precise molecular mechanisms remain debated .

Comparative Analysis with Homologs

MsbA homologs vary across species in sequence length, substrate specificity, and regulatory domains. Below is a comparison of MsbA proteins from related bacteria:

SpeciesUniProt IDLength (aa)Key FeaturesSource
Pseudomonas syringae pv. syringaeQ4ZZ16600Full-length, His-tagged, recombinant
Yersinia pestisQ8ZGA9582His-tagged, lipid A-core export
Pseudomonas fluorescensQ4KJB2601His-tagged, expressed in E. coli
Blochmannia floridanusQ7VR44583ABC transporter for lipid A-core

Notes:

  • Pseudomonas syringae pv. phaseolicola MsbA has not been explicitly characterized in available literature.

  • Structural conservation in TMDs and NBDs suggests functional similarity across species.

Role in Pathogenicity

While Pseudomonas syringae pv. phaseolicola MsbA has not been directly studied, homologs in other pathogens highlight its importance:

  • Lipid A-Core Deficiency: Disruption of MsbA in Pseudomonas aeruginosa reduces virulence and LPS production, impairing host colonization .

  • Antibiotic Resistance: MsbA homologs may contribute to multidrug efflux, though lipid A-core export remains the primary function .

Recombinant Protein Applications

Recombinant MsbA is used in:

  • Biochemical Assays: Studying ATPase activity and lipid A-core binding kinetics.

  • Vaccine Development: Potential target for immunotherapies, though no direct evidence exists for Pseudomonas syringae pv. phaseolicola.

Limitations and Future Directions

  • Species-Specific Data Gaps: No direct studies on Pseudomonas syringae pv. phaseolicola MsbA exist. Most insights derive from homologs.

  • Regulatory Complexity: Potential co-regulation with other virulence factors (e.g., type III secretion systems) remains unexplored .

  • Functional Redundancy: Overlapping roles with other ABC transporters (e.g., Mla system) in lipid trafficking require further elucidation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
msbA; PSPPH_0527; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
msbA
Target Protein Sequence
MTTSESSSTSSVKIYFRLLSYVRPHVGIFLLSIIGFVIFASTQPMLAGILKYFVDGLTNP EAVLFPNVPYLRELQLLQAVPLLIVLIAAWQGLGSFLGNYFLAKVSLGLVHDLRVELFNK LLVLPNRYFDTTNSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFIYLLMMNWKL TLVMLAILPLIAVMVGSASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGESYEQ NRFAQASDSNTRKQLRMTKTGAIYTPMLQLVIYSAMAVLMFLVLFLRGDATAGDLVAYIT AAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEEEVDTGTIERDRVTGHLEVKNLSF FYPQTERQVLNDISFSAAPGQMIALVGRSGSGKSTLANLIPRFYGHEMGNILLDGVEIND YRLRNLRKHIAQVNQNVTLFNDTIANNIAYGDLAGAPRADIEAAAADAYAKEFIDQLPQG FDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMKG RTTLVIAHRLSTIEKADMILVMDAGQIVERGTHTELLAQNGYYARLHAMGLDEPSPVGAV
Uniprot No.

Target Background

Function
This protein plays a vital role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MsbA in Pseudomonas syringae pv. phaseolicola?

MsbA functions as an essential ATP-binding cassette (ABC) transporter that acts as a lipid flippase in Gram-negative bacteria. In P. syringae pv. phaseolicola, as in other bacterial species, MsbA translocates lipid A-core (a critical component of lipopolysaccharide) from the inner leaflet to the outer leaflet of the cytoplasmic membrane . This process is absolutely required for bacterial viability, as demonstrated in E. coli studies . The model ABC transporter MsbA flips lipid A-core through the inner membrane, which is essential for the assembly of the outer membrane and bacterial survival .

How does the structure of MsbA enable its transport function?

MsbA operates as a homodimer of identical half-transporters. Each monomer contains:

  • A transmembrane domain (TMD) that forms the substrate pathway

  • A nucleotide-binding domain (NBD) that binds and hydrolyzes ATP

The TMDs contain intra-cytoplasmic loops (ICLs) that extend significantly further into the cytoplasm than those in ABC importers, forming a coupling interface with the NBD X-loops . This structural arrangement allows the coupling of nucleotide binding and hydrolysis to the mechanical energy required for substrate translocation . The transmembrane domain from the opposite subunit is responsible for the majority of the interaction interface between domains .

What conformational states does MsbA adopt during the transport cycle?

MsbA cycles between different conformational states:

Conformational StateNucleotide StatusTMD OrientationNBD ArrangementFunction
Inward-facingNucleotide-freeCytoplasm-accessibleSeparatedSubstrate binding
Outward-facingATP-boundPeriplasm-accessibleDimerizedSubstrate release
Transition stateADP-boundIntermediatePartially separatedReturn to resting state

Structural data supports an alternating access mechanism in MsbA, with distinct inward-facing and outward-facing conformations . Recent cryo-electron microscopy models of MsbA in lipid nanodiscs show that the NBD separation in the inward state is likely less dramatic than represented in crystal structures .

How are lipid A modifications regulated in Pseudomonas syringae pv. phaseolicola?

Lipid A modifications in P. syringae pv. phaseolicola are regulated by several enzymes and regulatory systems:

  • The PhoPQ two-component system likely regulates lipid A modification genes, similar to other Pseudomonas species

  • Three key modifying enzymes have been identified in P. syringae pv. phaseolicola 1448A:

    • PagL (PSPPH_1001) - involved in deacylation

    • LpxO (PSPPH_1567) - catalyzes hydroxylation

    • EptA (PSPPH_1546) - adds phosphoethanolamine

Studies have shown that knocking out these modification genes does not impair LPS formation or bacterial growth kinetics in vitro, suggesting some redundancy in the system .

How do lipid A modifications affect the substrate transported by MsbA?

Different lipid A species have been identified in P. syringae pv. phaseolicola through mass spectrometry analysis . These modifications likely alter the physicochemical properties of the substrate that MsbA must transport. The basic structure of lipid A is conserved across Pseudomonas species, with proteins involved in lipid A biosynthesis (LpxA, LpxC, LpxD, LpxH, LpxB, LpxK, LpxL, and LpxM) showing at least 72% sequence identity compared to P. aeruginosa PAO1 .

  • PagL orthologs show 59% sequence identity in P. syringae pv. phaseolicola 1448A compared to P. aeruginosa

  • This divergence may reflect adaptation to different environmental niches and host interactions

What experimental approaches can be used to study MsbA-lipid A interactions?

To investigate MsbA-lipid A interactions, researchers can employ multiple complementary approaches:

  • Genetic manipulation: Generate knockout strains of lipid A modification genes (pagL, lpxO, eptA) to isolate differentially modified lipid A species

  • Mass spectrometry: Analyze lipid A structures from different genetic backgrounds

  • Reconstitution systems: Incorporate purified MsbA into proteoliposomes with defined lipid A compositions

  • ATPase assays: Measure how different lipid A species affect MsbA's ATP hydrolysis rate

  • Transport assays: Track the movement of fluorescently labeled lipid A analogs in reconstituted systems

What key structural features distinguish ABC exporters like MsbA from importers?

MsbA and other ABC exporters have several distinguishing structural features:

  • The X-loop (TEVGERV) is confined to exporters and interacts with coupling helices from each TMD to mediate structural changes

  • The TMDs contain intra-cytoplasmic loops (ICLs) extending much further into the cytoplasm than those in importers

  • The coupling interface between TMDs and NBDs differs, with exporters utilizing the X-loop for interaction

These structural distinctions reflect the fundamentally different mechanisms of substrate transport between importers and exporters.

How has the structure of MsbA been determined experimentally?

Multiple complementary techniques have been used to determine MsbA structure:

  • X-ray crystallography has captured MsbA in both inward-facing and outward-facing conformations

  • Cryo-electron microscopy, particularly with MsbA in lipid nanodiscs, has provided more physiologically relevant structural information

  • Electron paramagnetic resonance spectroscopy has corroborated the channel conformations suggested by crystal structures

The inward-facing MsbA crystals, obtained without nucleotide substrates, show large separations between NBDs that may not represent physiologically relevant states . Cryo-EM studies suggest the actual NBD separation in functional transporters is less dramatic .

What is the "outward-only" mechanism proposed for some ABC exporters?

An alternative to the alternating access model is the "outward-only" mechanism proposed for some ABC exporters:

  • The transporter maintains an outward-facing orientation throughout the entire export process

  • The lipid component of the substrate remains within the lipid bilayer, associated with the outside of the TMDs

  • An essential external helix on each TMD creates a hydrophobic groove that anchors the lipid in place

  • The polar head group (like pyrophosphate) is electrostatically attracted into the transporter lumen by arginine residues

This mechanism represents a substantial divergence from the alternating-access model described for MsbA .

What are key considerations for expressing recombinant P. syringae pv. phaseolicola MsbA?

ParameterConsiderationsRecommendations
Expression systemHost compatibilityE. coli C41/C43 strains designed for membrane proteins
Induction conditionsTemperature, timeLower temperature (16-20°C), extended induction (16-24h)
Fusion tagsPurification strategyC-terminal His6 or His10 tags avoid interference with TMD insertion
Detergent selectionMembrane extractionInitial screen of DDM, LMNG, UDM for optimal solubilization
Buffer compositionProtein stabilityInclude 10-20% glycerol, physiological salt (150-300mM NaCl)
Quality controlFunctional verificationATPase activity assay must be performed post-purification

How can researchers verify the functional integrity of purified recombinant MsbA?

Functional assessment of purified MsbA can be performed using several complementary approaches:

  • ATPase activity assay: Measuring ATP hydrolysis rates using colorimetric methods

  • Tryptophan fluorescence: Monitoring conformational changes upon ATP binding

  • Thermal stability assays: Differential scanning fluorimetry to assess protein folding

  • Reconstitution studies: Incorporation into liposomes to measure lipid flipping activity

  • Complementation testing: Determine if P. syringae MsbA can functionally replace E. coli MsbA in conditional mutants

How does P. syringae pv. phaseolicola MsbA compare to other bacterial MsbA homologs?

Comparative analysis of MsbA across bacterial species reveals both conservation and specialization:

  • The basic architecture and mechanism appear conserved across Gram-negative bacteria

  • The NBDs contain highly conserved motifs (Walker A/B, signature sequence) essential for ATP binding and hydrolysis

  • TMD regions may show greater variation, potentially reflecting differences in lipid A structure between species

  • Pseudomonas species show considerable variation in proteins involved in lipid A modification, with sequence identities ranging from 59-67% compared to P. aeruginosa

What role might MsbA play in P. syringae pv. phaseolicola pathogenesis?

As a plant pathogen, P. syringae pv. phaseolicola depends on proper outer membrane assembly for host interaction and virulence:

  • MsbA is essential for LPS export to the outer membrane

  • LPS modifications mediated by PagL, LpxO, and EptA may influence host recognition and immune response

  • Disruption of these pathways could affect bacterial survival during plant infection

  • While direct virulence studies with MsbA mutants are challenging due to its essential nature, conditional mutants could reveal its importance in plant-pathogen interactions

How might inhibitors of MsbA affect bacterial viability?

Given MsbA's essential role, it represents a potential target for antimicrobial development:

  • Inhibitors targeting the NBDs could block ATP binding or hydrolysis

  • Compounds interfering with the TMD region might prevent substrate binding or translocation

  • Molecules disrupting the coupling between ATP hydrolysis and conformational changes could uncouple energy expenditure from transport

  • The high conservation of MsbA across Gram-negative bacteria suggests broad-spectrum activity potential

What are the main challenges in studying recombinant P. syringae pv. phaseolicola MsbA?

Several technical challenges complicate research on this protein:

  • As a membrane protein, expression and purification in a functional state remains difficult

  • Maintaining native-like lipid environments for functional studies requires specialized approaches

  • The essential nature of MsbA makes genetic manipulation challenging

  • Species-specific lipid A modifications may affect MsbA function in ways difficult to recapitulate in heterologous systems

What emerging technologies might advance our understanding of MsbA function?

Recent technological advances offer new opportunities for MsbA research:

  • Cryo-electron microscopy: Capturing multiple conformational states without crystallization

  • Native mass spectrometry: Analyzing membrane protein complexes with associated lipids

  • Single-molecule FRET: Monitoring conformational dynamics in real-time

  • Nanodiscs: Providing a more native-like membrane environment for structural and functional studies

  • In silico modeling: Predicting interactions between MsbA and modified lipid A species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.