Recombinant Pseudomonas syringae pv. phaseolicola NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

Expression and Purification
Recombinant nuoA is expressed in E. coli using optimized protocols. The His-tag facilitates nickel-affinity chromatography, yielding >90% purity as confirmed by SDS-PAGE .

Enzymatic Activity and Function
As part of the NDH complex (Complex I), nuoA participates in:

  • Electron Transfer: Transfers electrons from NADH to quinones in the respiratory chain .

  • Proton Translocation: Contributes to proton pumping across the membrane, generating an electrochemical gradient .

  • EC Classification: EC 1.6.99.5 (NADH dehydrogenase) .

Enzymatic FeatureDescription
Substrate SpecificityNADH → Quinones
Ion PumpingCouples electron transfer to proton translocation
Energy ConservationGenerates ATP via proton motive force

Comparative Analysis with Other Pseudomonas Strains

Sequence and Functional Similarity
nuoA shares high homology with subunit A from Pseudomonas syringae pv. syringae (Q4ZRJ3) and Pseudomonas aeruginosa (e.g., PAO1) .

StrainUniProt IDAA IdentityKey Difference
P. syringae pv. phaseolicolaQ48H54Pathogen of beans
P. syringae pv. syringaeQ4ZRJ3~95%Causal agent of bacterial blight
P. aeruginosaPAO1 homolog~80%Role in human opportunistic infections

Research Findings and Implications

Mechanistic Studies

  • NADH Oxidation: In P. aeruginosa, NADH dehydrogenases (NUO, NQR, NDH2) exhibit distinct activities, with NUO being critical for anaerobic growth and virulence .

  • Proton Pumping: Structural studies suggest nuoA forms a proton channel, essential for ATP synthesis .

Pathogenicity Links
Mutations in nuoF (a homologous subunit in Ralstonia solanacearum) disrupt biofilm formation and virulence, highlighting the broader role of NDH complexes in bacterial pathogenicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nuoA; PSPPH_3109; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
nuoA
Target Protein Sequence
MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARL RLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGA LDWAPEGRRNRQAKLKQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, harnessing the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of NADH-quinone oxidoreductase subunit A (nuoA) in Pseudomonas syringae pv. phaseolicola?

    NADH-quinone oxidoreductase subunit A (nuoA) is a membrane protein component of the NDH-1 complex (NADH dehydrogenase I) in P. syringae pv. phaseolicola. According to protein databases, nuoA consists of 137 amino acids with a sequence of "MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARLRLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGALDWAPEGRRNRQAKLKQ" . The protein contains transmembrane domains and functions as part of the proton-pumping NADH dehydrogenase complex, which is homologous to mitochondrial complex I. This complex plays a critical role in the bacterial respiratory chain by oxidizing NADH to NAD+ while contributing to the proton motive force across the membrane .

  • How do NADH dehydrogenases contribute to bacterial bioenergetics in Pseudomonas species?

    In Pseudomonas species, NADH dehydrogenases play crucial roles in cellular bioenergetics through several mechanisms:

    • Electron transport: They oxidize NADH to NAD+ and transfer electrons to the quinone pool

    • Proton translocation: NDH-1 (containing nuoA) translocates protons across the membrane, contributing to the proton motive force

    • Respiratory flexibility: Multiple NADH dehydrogenases (NDH-1, NDH-2, and Nqr) provide metabolic versatility under different environmental conditions

    Studies in P. aeruginosa have demonstrated that NDH-1 and NDH-2 are largely redundant under aerobic conditions, but NDH-1 is specifically required for robust growth under anaerobic conditions . This respiratory flexibility contributes to the ability of Pseudomonas species to thrive in diverse environments.

  • What are the common expression systems used for recombinant production of nuoA?

    Recombinant nuoA from P. syringae pv. phaseolicola is typically expressed in E. coli expression systems. Based on available research data, the following approaches are commonly employed:

    • Vector systems: pET series vectors (like pET28a) with T7 promoters are frequently used

    • Tags: N-terminal His-tags are commonly added to facilitate purification by Ni-NTA affinity chromatography

    • Expression conditions: Induction with IPTG at lower temperatures (16-25°C) helps improve proper folding of membrane proteins

    • Strain selection: E. coli strains like BL21(DE3) or TOP10 are preferred for membrane protein expression

    For example, when expressing recombinant P. syringae pv. phaseolicola nuoA protein, researchers have successfully used E. coli as the host with N-terminal His-tagging, followed by purification under non-denaturing conditions to maintain protein structure and function .

  • What is the relationship between NADH dehydrogenases and virulence in phytopathogenic bacteria?

    NADH dehydrogenases significantly contribute to virulence in phytopathogenic bacteria like P. syringae through several mechanisms:

    • Energy production: They provide the metabolic energy required for virulence factor expression and secretion

    • Adaptation to host environments: They enable bacterial survival under the varying oxygen levels encountered during plant infection

    • Stress resistance: They contribute to bacterial resilience against host-generated oxidative stress

    Research in P. aeruginosa (which shares respiratory features with P. syringae) has demonstrated that mutants lacking NDH-1 function show reduced virulence in both plant and insect models. Specifically, loss of NDH-1 leads to less tissue damage in plant infection models and slower progression of infection in insect models . This suggests that targeting NADH dehydrogenases could potentially reduce bacterial virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.