Recombinant Pseudomonas syringae pv. phaseolicola NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System

  • Host: Escherichia coli .

  • Tag: N-terminal His tag for affinity chromatography .

Role in Bacterial Metabolism

  • NADH-quinone oxidoreductase is part of Complex I in the respiratory chain, essential for ATP synthesis .

  • In P. syringae pv. phaseolicola, this enzyme supports survival under low-nutrient conditions encountered in plant apoplasts .

Link to Pathogenesis

  • While nuoK itself is not directly implicated in phaseolotoxin synthesis, genes encoding metabolic enzymes like nuoK are upregulated during host colonization .

  • Mutants of related nuo genes in P. syringae show reduced virulence, suggesting a role in energy production during infection .

Genomic Context and Evolution

Genomic Comparisons

FeatureP. syringae pv. phaseolicola 1448AP. syringae pv. tomato DC3000
Chromosome size (bp)5,928,7876,397,126
G+C content58.0%58.4%
Gene count5,1445,615
Comparative genomics highlights conserved respiratory chain components across pathovars .

Applications in Research

  • Enzyme kinetics: Used to study quinone-binding efficiency and proton translocation mechanisms .

  • Pathogen-host interaction studies: Serves as a marker for metabolic adaptation during plant colonization .

  • Antibiotic development: Potential target for disrupting bacterial energy metabolism .

Key Research Findings

  • Temperature-dependent expression: Genes in the nuo operon are thermoregulated, aligning with phaseolotoxin production at 18–20°C .

  • Conservation: The nuoK sequence is highly conserved among P. syringae pathovars, indicating functional indispensability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; PSPPH_3118; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
nuoK
Target Protein Sequence
MNAIPLEHGLAVAGVLFCLGLVGLMVRRNILFVLMSLEIMMNASALAFVVAGSRWAQPDG QVMFILVISLAAAEASIGLAILMQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. It couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase subunit K (nuoK) in Pseudomonas syringae pv. phaseolicola?

NADH-quinone oxidoreductase subunit K (nuoK) functions as an integral membrane component of Complex I in the bacterial respiratory chain. In Pseudomonas syringae pv. phaseolicola, nuoK contributes to the proton translocation mechanism that couples electron transfer from NADH to quinone with proton pumping across the membrane. To investigate this function experimentally, researchers should employ:

  • Membrane potential measurements using fluorescent probes (e.g., DiSC3)

  • Oxygen consumption rate analysis with a Clark-type electrode

  • Site-directed mutagenesis targeting conserved residues

  • Proton pumping assays using pH-sensitive fluorophores

The hydrophobic nature of nuoK (containing predominantly non-polar amino acids) facilitates its integration into the membrane domain of the complex, where it participates in forming the proton translocation pathway. Current evidence suggests that nuoK contains transmembrane helices that contribute to the conformational changes required for proton pumping during the catalytic cycle .

How should recombinant nuoK protein be stored and handled for optimal stability?

Proper storage and handling of recombinant nuoK protein is critical for maintaining its structural integrity and functional activity. Based on established protocols, the following methodological approaches are recommended:

  • Initial preparation:

    • Upon receipt, briefly centrifuge the vial containing lyophilized protein

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for long-term storage

  • Storage conditions:

    • Store reconstituted protein at -20°C/-80°C in small working aliquots

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • For short-term use (up to one week), store working aliquots at 4°C

  • Buffer considerations:

    • The protein is optimally stable in Tris/PBS-based buffer at pH 8.0

    • Inclusion of 6% trehalose enhances stability during freeze-thaw cycles

  • Quality control measures:

    • Periodically verify protein integrity using SDS-PAGE

    • Monitor activity using appropriate functional assays

    • Check for precipitation or aggregation before each use

What expression systems are most effective for producing recombinant nuoK protein?

Selecting an appropriate expression system is crucial for obtaining functionally active recombinant nuoK protein. The methodological considerations include:

  • Prokaryotic expression systems:

    • E. coli BL21(DE3) has proven effective for nuoK expression, particularly when using pET vector systems with T7 promoters

    • Codon optimization may be necessary as Pseudomonas and E. coli have different codon usage preferences

    • For membrane proteins like nuoK, lower induction temperatures (16-20°C) often improve proper folding

  • Expression optimization strategies:

    • Use of fusion tags (particularly N-terminal His tags) facilitates purification without compromising function

    • Addition of membrane-mimicking environments during expression (e.g., mild detergents)

    • Controlled expression using auto-induction media or tightly regulated inducible promoters

  • Purification approach:

    • Two-phase extraction using detergents like n-dodecyl β-D-maltoside (DDM)

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography as a polishing step

The published protocols indicate that E. coli expression systems with N-terminal His tags provide yields of >90% pure protein when appropriate detergents are used during extraction and purification .

How can researchers verify the purity and functional activity of recombinant nuoK?

Quality assessment of recombinant nuoK requires a multi-faceted approach addressing both purity and functional integrity:

  • Purity verification methods:

    • SDS-PAGE analysis with Coomassie or silver staining (target: >90% purity)

    • Western blotting using anti-His antibodies for tagged proteins

    • Mass spectrometry for exact mass determination and sequence verification

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure characteristics

    • Limited proteolysis to verify proper folding

    • Dynamic light scattering to check for aggregation

  • Functional activity assays:

    • Integration into proteoliposomes followed by proton pumping measurements

    • Reconstitution with other complex I subunits to assess complex formation

    • NADH oxidation activity measurements in membrane preparations

  • Troubleshooting considerations:

    • If activity is low, verify membrane insertion using flotation assays

    • Assess protein oligomerization state using native PAGE

    • Consider alternative detergents if the protein shows poor stability

What genetic engineering techniques are most effective for modifying the nuoK gene in Pseudomonas syringae?

For targeted modification of the nuoK gene in Pseudomonas syringae, several advanced genetic engineering approaches can be employed:

  • RecTE-mediated recombineering:

    • The Pseudomonas syringae RecT homolog promotes efficient recombination of single-stranded DNA oligonucleotides

    • For double-stranded DNA recombination, both RecT and RecE homologs should be expressed

    • This system allows for precise genomic modifications without leaving selection markers

  • Implementation protocol:

    • Clone the RecT and RecE genes from Pseudomonas syringae pv. syringae B728a

    • Express these recombination proteins from plasmid pUCP24/47 or similar vectors

    • Introduce linear DNA containing homology arms (40-50 bp) flanking the desired modification site

    • Select recombinants using appropriate markers

    • Counter-select with sacB to eliminate the recombineering plasmid after modification

  • Modifications for membrane proteins:

    • Point mutations in transmembrane regions require careful design to maintain hydrophobicity

    • For domain swapping, junction points should be in loop regions rather than within helices

    • Fusion tags should be added at termini with flexible linkers

  • Verification strategy:

    • Colony PCR for initial screening

    • Sequencing to confirm precise modifications

    • Functional complementation assays to verify activity

How can researchers address unexpected data or contradictory results when studying nuoK function?

When faced with contradictory data during nuoK research, a systematic troubleshooting approach should be implemented:

  • Data validation framework:

    • Thoroughly examine the data to identify specific discrepancies

    • Compare results with published literature on similar membrane proteins

    • Analyze outliers that may significantly influence interpretations

    • Evaluate whether contradictions arise from technical or biological factors

  • Methodological reassessment:

    • Review experimental design for potential confounding variables

    • Consider protein stability issues specific to membrane proteins

    • Evaluate detergent effects on protein activity

    • Assess whether the contradictions could result from different conformational states

  • Alternative hypothesis development:

    • Formulate new hypotheses that might explain the contradictory data

    • Design critical experiments that can distinguish between competing explanations

    • Implement additional controls to rule out technical artifacts

  • Refined experimental approach:

    • Modify protein purification protocols to preserve native conformation

    • Use complementary techniques to validate findings (e.g., biochemical and structural methods)

    • Adjust environmental conditions to mimic physiological membrane environments

    • Consider the impact of protein-lipid interactions on observed function

How does the structure-function relationship of nuoK in Pseudomonas syringae compare with homologous proteins in other bacteria?

Comparative analysis of nuoK across bacterial species provides valuable insights into evolutionary conservation and functional specialization:

  • Sequence alignment methodology:

    • Utilize BLASTP to identify homologs across diverse bacterial species

    • Perform multiple sequence alignment using MUSCLE or CLUSTALW algorithms

    • Identify conserved residues, particularly in transmembrane regions

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Structural comparison approaches:

    • Homology modeling based on available crystal structures (e.g., E. coli Complex I)

    • Conservation mapping onto structural models to identify functional hotspots

    • Analysis of coevolving residues to identify interaction networks

  • Comparative functional analysis:

    • Cross-species complementation experiments to test functional conservation

    • Site-directed mutagenesis of species-specific residues

    • Biochemical characterization of homologs under standardized conditions

OrganismKey Structural DifferencesFunctional Implications
P. syringae pv. phaseolicola102 amino acids with specific membrane-spanning regionsAdapted to the Pseudomonas membrane environment
E. coliSimilar core structure with variations in loop regionsDifferences in quinone binding specificity
Other Pseudomonas speciesGenerally high conservation (>80%)Potential adaptations to different ecological niches

The nuoK protein, while performing similar functions across species, shows adaptations that may reflect differences in respiratory metabolism and environmental adaptation .

What are the challenges in studying protein-protein interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Investigating the interactome of membrane-embedded nuoK presents unique technical challenges that require specialized approaches:

  • In vivo interaction analysis:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • FRET-based approaches using fluorescently labeled subunits

    • In vivo crosslinking followed by mass spectrometry

    • Split-GFP complementation assays for direct visualization

  • Structural biology approaches:

    • Cryo-electron microscopy of the intact complex

    • Crosslinking coupled with mass spectrometry (XL-MS)

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Site-directed spin labeling for EPR distance measurements

  • Computational prediction methods:

    • Molecular dynamics simulations of the membrane-embedded complex

    • Coevolutionary analysis to identify coevolving residue pairs

    • Docking simulations guided by experimental constraints

  • Functional validation strategies:

    • Mutational analysis of predicted interaction interfaces

    • Charge reversal experiments for electrostatic interactions

    • Reconstitution assays with purified components to verify direct interactions

The highly hydrophobic nature of nuoK necessitates careful selection of detergents and membrane mimetics to maintain native-like interactions when studied in isolation from the membrane environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.