Recombinant Pseudomonas syringae pv. phaseolicola Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; PSPPH_2020; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
kdpC
Target Protein Sequence
MSNVLRPALSLIVLMSLITGVAYPLVVTGVAQVAFPAQANGSLVYDAAGKVRGSALIAQS FTGDEWFQSRPSAGAFATVASGASNFAPSNPALVTRVKEDVAKLANASQEPVPLALLTTS GSGLDPHLSPEAIAWQAGRVAAARQLPLEKVQALIDANTQRPLIGPPVVNVLALNMSLNQ LPSAPRNAQL
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does the kdpC gene expression relate to pathogenicity in P. syringae pv. phaseolicola?

The kdpC gene in P. syringae pv. phaseolicola is part of the complex genetic machinery that regulates potassium homeostasis, which is critical for bacterial survival during plant infection. While not directly linked to virulence in the same way as phaseolotoxin synthesis genes, the KdpFABC system plays an important role in bacterial adaptation to the potassium-limited environment of the plant apoplast .

Studies have shown that bacterial pathogens must carefully regulate ion homeostasis during infection, and the KdpFABC system helps the bacteria maintain appropriate K+ levels when subjected to osmotic stress and ion-limited conditions within plant tissues. Genomic island analysis of P. syringae pv. phaseolicola has revealed that genes related to basic metabolic functions, including ion transport systems like KdpFABC, are highly conserved among pathovars, suggesting their fundamental importance for bacterial fitness during plant colonization .

Unlike virulence factors such as phaseolotoxin, which shows temperature-dependent expression patterns (optimal at 18-20°C) , kdpC expression appears to be more directly responsive to environmental K+ levels rather than temperature.

What genomic context surrounds the kdpC gene in P. syringae pv. phaseolicola?

The kdpC gene in P. syringae pv. phaseolicola is part of the kdpFABC operon, which encodes the four membrane-bound subunits of the high-affinity potassium transport system. In the sequenced P. syringae pv. phaseolicola strain 1448A genome, kdpC is designated as PSPPH_2020 .

The genomic organization follows the typical arrangement seen in other bacterial species, with the genes ordered as kdpF, kdpA, kdpB, and kdpC . This operon is generally chromosomally encoded, not located on mobile genetic elements like genomic islands or plasmids, unlike some virulence factors . The KdpFABC system is part of the core Pseudomonas genome, with comparative genomic analysis revealing that approximately 67% of the P. syringae pv. phaseolicola genome is shared with other Pseudomonas species .

Adjacent to the kdpFABC operon, many bacteria (including Pseudomonas species) have the kdpDE two-component regulatory system, which senses potassium limitation and controls expression of the kdpFABC genes .

How does the cryo-EM structure of KdpFABC inform our understanding of KdpC's role in potassium transport?

Recent cryo-EM structures of the KdpFABC complex have provided significant insights into the mechanistic role of KdpC in K+ transport. The structures reveal that the 157 kDa asymmetric complex can adopt at least two conformational states (E1 and E2), resolved at 3.7 Å and 4.0 Å resolution respectively .

Contrary to previous assumptions, the structural analysis suggests a translocation pathway through two half-channels along KdpA and KdpB, uniting the alternating-access mechanism of actively pumping P-type ATPases with the high affinity and selectivity of K+ channels . In this model, KdpC appears to play a stabilizing role, particularly near the selectivity filter.

The structural data supports a transport mechanism where KdpC interacts closely with KdpA, helping maintain the structural integrity of the complex during conformational changes associated with ion transport. Based on the observed proximity of KdpC to the selectivity filter, researchers have proposed that:

  • KdpC functions similar to β subunits of Na+/K+ ATPase and gastric H+ ATPase

  • KdpC likely increases K+ affinity in the complex

  • KdpC helps stabilize the outward-open half-channel configuration in the E1 state

These structural insights suggest that the KdpFABC complex represents a true chimeric transport mechanism that combines features of both channels and pumps, with KdpC playing a key supporting role in maintaining the architecture required for efficient potassium transport .

What methodological approaches have been used to characterize the function of KdpC in P. syringae pv. phaseolicola?

Researchers have employed multiple complementary approaches to elucidate KdpC function in P. syringae pv. phaseolicola and related systems:

Genetic and Molecular Techniques:

  • Targeted gene deletion using CRISPR-based tools or transposon mutagenesis to create kdpC null mutants

  • Complementation studies using various kdpC constructs to restore function in mutant strains

  • Creation of chimeric constructs between kdpC genes from different bacterial species to identify functional domains

  • RNA sequencing and transcriptomic analysis to examine kdpC expression patterns under various conditions

Structural Biology Approaches:

  • Cryo-electron microscopy to determine the structure of the KdpFABC complex at near-atomic resolution

  • X-ray crystallography of the KdpFABC complex to determine static structures

  • Computational modeling and molecular dynamics simulations to predict protein movements during transport cycles

Biochemical and Biophysical Methods:

  • Purification of recombinant KdpC protein using affinity tags (e.g., His-tag)

  • In vitro reconstitution of KdpFABC complexes in liposomes to measure transport activity

  • ATP hydrolysis assays to assess functional coupling between KdpB and other subunits

  • Isothermal titration calorimetry to measure potassium binding affinity

In vivo Functional Assays:

  • Growth assays under potassium-limited conditions to assess functional importance of KdpC

  • Competition assays to determine the contribution of KdpC to bacterial fitness

  • Plant infection studies to assess the role of KdpC during pathogenesis

These multidisciplinary approaches have collectively provided insights into the structural and functional properties of KdpC, though many aspects of its precise mechanistic role remain to be fully characterized.

How does the amino acid sequence of KdpC from P. syringae pv. phaseolicola compare with other bacterial species, and what functional implications do these differences have?

Comparative sequence analysis of KdpC proteins reveals both conserved and variable regions across bacterial species. The KdpC protein from P. syringae pv. phaseolicola (190 amino acids) shares significant homology with KdpC from other Pseudomonas species, but shows more divergence when compared to distantly related bacteria.

Sequence Conservation Patterns:

SpeciesSequence Identity (%)Functional Complementation with E. coliKey Differences
P. syringae pv. tomato~95YesFew amino acid substitutions in transmembrane region
P. aeruginosa~85YesVariations in C-terminal region
E. coli~60-Different N-terminal transmembrane segment
C. acetobutylicum~40NoMajor differences in both terminal regions
M. tuberculosis~45YesConserved central domain despite divergence

Sequence alignment studies have identified several functionally important regions in KdpC:

  • A single N-terminal transmembrane segment

  • A conserved central domain

  • A species-variable C-terminal region

Experimental complementation studies with hybrid constructs have demonstrated that the N-terminal transmembrane segment and the C-terminal-third of the protein can be exchanged between some species (e.g., between E. coli and C. acetobutylicum), but only one region at a time. Simultaneous substitution of both regions prevents complementation, suggesting these regions work together in a species-specific manner .

What are the optimal conditions for expressing and purifying recombinant KdpC from P. syringae pv. phaseolicola?

Expression System Optimization:

The recombinant KdpC protein from P. syringae pv. phaseolicola can be successfully expressed using E. coli expression systems. Based on current research methodologies, the following approach is recommended:

  • Construct Design:

    • Clone the full-length kdpC gene (encoding amino acids 1-190) into an expression vector with an N-terminal His-tag

    • Codon optimization may improve expression in E. coli hosts

    • Consider including a TEV protease cleavage site if tag removal is required

  • Expression Conditions:

    • Host strain: BL21(DE3) or Rosetta(DE3) for rare codon optimization

    • Culture medium: LB or TB supplemented with appropriate antibiotics

    • Induction: 0.5 mM IPTG when OD600 reaches 0.6-0.8

    • Post-induction growth: 18°C for 16-18 hours (lower temperature reduces inclusion body formation)

  • Purification Protocol:

    • Cell lysis: Sonication or pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF

    • Membrane fraction isolation: Ultracentrifugation at 100,000×g for 1 hour

    • Solubilization: 1% DDM or LMNG detergent in lysis buffer for 1-2 hours at 4°C

    • Affinity chromatography: Ni-NTA resin with gradient elution (20-300 mM imidazole)

    • Size exclusion chromatography: Superdex 200 in buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% DDM or LMNG

  • Storage:

    • Store purified protein at -20°C or -80°C in buffer containing 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

The protein yield typically ranges from 1-5 mg per liter of bacterial culture. The purity should be verified by SDS-PAGE and Western blotting using anti-His antibodies, with expected purity >90% for structural and biochemical studies.

How can researchers effectively study the interaction between KdpC and other subunits of the KdpFABC complex in P. syringae pv. phaseolicola?

Studying the interactions between KdpC and other components of the KdpFABC complex requires specialized approaches due to the membrane-associated nature of these proteins. Here are methodological strategies for investigating these interactions:

Co-Purification and Reconstitution Approaches:

  • Co-expression systems:

    • Design polycistronic constructs containing kdpF, kdpA, kdpB, and kdpC genes

    • Use differential tagging (e.g., His-tag on KdpC, FLAG-tag on KdpB) to verify co-purification

    • Optimize detergent conditions to maintain complex integrity during purification

  • Crosslinking studies:

    • Apply chemical crosslinkers (e.g., DSS, BS3) to stabilize transient interactions

    • Use photo-crosslinking with genetically incorporated unnatural amino acids for site-specific crosslinking

    • Analyze crosslinked products by mass spectrometry to identify interaction interfaces

Biophysical Interaction Analysis:

  • Fluorescence-based methods:

    • Förster Resonance Energy Transfer (FRET) between fluorescently labeled subunits

    • Fluorescence correlation spectroscopy to determine complex formation kinetics

    • Site-directed fluorescence labeling to monitor conformational changes

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified KdpC on sensor chips using His-tag capture

    • Flow other complex components individually or in combination

    • Determine binding kinetics and affinity constants

Structural and Computational Approaches:

  • Cryo-EM analysis:

    • Prepare samples of the full KdpFABC complex

    • Collect and process data to resolve subunit interfaces

    • Compare with structures from other organisms to identify conserved interaction motifs

  • Computational modeling:

    • Molecular dynamics simulations to predict dynamic interactions

    • Interface prediction algorithms to identify potential binding surfaces

    • Mutagenesis design to test predicted interactions

Functional Validation Methods:

  • Mutagenesis studies:

    • Generate point mutations in predicted interface residues

    • Assess effects on complex assembly and potassium transport function

    • Perform complementation studies in kdpC deletion strains

  • Transport activity measurements:

    • Reconstitute wild-type and mutant complexes in proteoliposomes

    • Measure potassium transport using fluorescent indicators (e.g., PBFI) or radioactive tracers (86Rb+)

    • Correlate transport activity with complex stability

These methods can be combined to build a comprehensive understanding of how KdpC interacts with other components of the KdpFABC complex in P. syringae pv. phaseolicola, providing insights into both structural arrangements and functional relationships.

What new technologies are emerging for studying the role of KdpC in potassium homeostasis during plant infection by P. syringae pv. phaseolicola?

Several cutting-edge technologies are enhancing our ability to study KdpC function in the context of plant-pathogen interactions:

Advanced Imaging Technologies:

  • Super-resolution microscopy:

    • Single-molecule localization microscopy (PALM/STORM) to visualize KdpC distribution in bacterial cells during infection

    • Stimulated emission depletion (STED) microscopy to observe co-localization with other bacterial proteins

    • Correlative light and electron microscopy (CLEM) to connect protein localization with cellular ultrastructure

  • In planta imaging:

    • Fluorescent protein fusions (e.g., KdpC-mScarlet) for real-time visualization during infection

    • Light sheet microscopy for minimally invasive long-term imaging of bacterial behavior in plant tissues

    • Multiphoton microscopy for deeper tissue penetration when imaging bacteria in plant leaves

Genomic and Transcriptomic Approaches:

  • CRISPR-based technologies:

    • CRISPR interference (CRISPRi) for tunable repression of kdpC expression

    • CRISPR activation (CRISPRa) to upregulate expression under non-inducing conditions

    • Base editing for introducing specific mutations without double-strand breaks

  • Single-cell technologies:

    • Single-cell RNA sequencing to examine heterogeneity in kdpC expression within bacterial populations

    • Spatial transcriptomics to correlate gene expression with location in the infection site

    • Ribosome profiling to assess translational regulation of KdpC synthesis

Biosensors and Real-time Monitoring:

  • Ion-specific biosensors:

    • Genetically encoded potassium sensors (e.g., GEPII) to monitor K+ levels in bacterial cells

    • Surface-enhanced Raman spectroscopy (SERS) nanosensors for detecting ion fluxes

    • Fluorescence lifetime imaging microscopy (FLIM) for quantitative ion concentration measurements

  • Activity sensors:

    • ATP consumption reporters linked to KdpB activity

    • Conformational biosensors based on fluorescent protein insertions in KdpC

    • FRET-based reporters for monitoring protein-protein interactions in the complex

Microfluidic and Organ-on-Chip Technologies:

  • Plant-microbe interaction devices:

    • Microfluidic leaf-mimicking devices that recreate the apoplastic environment

    • Dual-compartment systems to study bacterial responses to plant defensive compounds

    • Gradient generators to assess bacterial chemotaxis toward plant-derived signals

  • High-throughput phenotyping:

    • Droplet microfluidics for single-cell analysis of bacterial responses to potassium limitation

    • Automated imaging platforms for tracking bacterial growth under various ionic conditions

    • Multiplexed assays for simultaneous assessment of multiple ion transport systems

These emerging technologies provide unprecedented opportunities to study KdpC function in P. syringae pv. phaseolicola during the infection process, connecting molecular mechanisms to pathogen fitness and virulence in planta.

How can researchers effectively integrate data from genomic, transcriptomic, and structural studies to develop a comprehensive model of KdpC function in P. syringae pv. phaseolicola?

Integrating diverse datasets to build a comprehensive model of KdpC function requires a strategic multi-omics approach:

Data Integration Framework:

  • Establish a unified data repository:

    • Create a database containing genomic, transcriptomic, proteomic, and structural data

    • Implement consistent metadata standards to facilitate cross-dataset comparisons

    • Develop API access for computational analysis across different data types

  • Multi-scale modeling approach:

    • Connect atomic-level structural data to system-level physiological responses

    • Integrate models across different time scales (ns to hours) and spatial scales (Å to µm)

    • Use machine learning to identify patterns across heterogeneous datasets

Methodological Workflow:

  • Genomic context analysis:

    • Comparative genomics to identify conserved regions and species-specific adaptations

    • Synteny analysis of the kdpFABC operon across Pseudomonas species

    • Identification of regulatory elements through promoter analysis and ChIP-seq

  • Expression pattern integration:

    • RNA-seq under diverse conditions (K+ limitation, plant infection, temperature stress)

    • Proteomics to validate expression and identify post-translational modifications

    • Correlation analysis between kdpC expression and other bacterial systems

  • Structure-function mapping:

    • Molecular dynamics simulations based on cryo-EM structures

    • Functional validation of predicted mechanisms through site-directed mutagenesis

    • Identification of allosteric networks connecting KdpC to other subunits

  • Host-pathogen interface analysis:

    • Dual RNA-seq during infection to capture both plant and bacterial responses

    • Spatial transcriptomics to localize kdpC expression patterns within infection sites

    • Metabolomics to assess the impact of K+ transport on bacterial metabolism during infection

Computational Integration Strategies:

  • Network biology approaches:

    • Construct protein-protein interaction networks centered on KdpC

    • Develop gene regulatory networks connecting KdpC to broader cellular responses

    • Identify functional modules and pathways linked to potassium homeostasis

  • Systems biology modeling:

    • Kinetic models of the KdpFABC complex based on structural and biochemical data

    • Whole-cell models incorporating KdpC function into cellular physiology

    • Agent-based models of bacterial population dynamics during infection

  • Visualization tools:

    • Interactive platforms for exploring multi-dimensional datasets

    • 3D visualizations connecting structural features to functional outcomes

    • Time-series representations of KdpC activity during infection progression

This integrated approach enables researchers to build a comprehensive model that connects the molecular structure of KdpC to its physiological role in potassium homeostasis and ultimately to P. syringae pv. phaseolicola pathogenesis.

How does the role of KdpC in P. syringae pv. phaseolicola compare with its function in other bacterial pathogens?

The KdpC subunit of the high-affinity potassium transport system shows both conserved and divergent features across bacterial pathogens:

Comparative Analysis of KdpC Across Pathogens:

Bacterial PathogenKdpC Size (aa)Host EnvironmentNotable AdaptationsReference
P. syringae pv. phaseolicola190Plant apoplastOptimized for plant ion environment
P. aeruginosa183Human tissues, environmentalInvolved in biofilm formation
E. coli pathotypes190Intestinal tractWell-characterized regulatory system
M. tuberculosis~190Human macrophagesFunctions in low K+ environment of phagosome
L. monocytogenes~190Food, human cellsActive during intracellular growth

The fundamental role of KdpC in stabilizing the KdpFABC complex appears conserved across bacterial species, but several pathogen-specific adaptations have been documented:

These comparisons highlight how a conserved bacterial system has evolved pathogen-specific adaptations while maintaining its core function in potassium homeostasis, demonstrating both the evolutionary conservation and specialization of KdpC across diverse bacterial pathogens.

What is currently known about the regulation of kdpC gene expression in P. syringae pv. phaseolicola under different environmental conditions?

The regulation of kdpC expression in P. syringae pv. phaseolicola involves complex responses to environmental signals:

Regulatory Mechanisms:

  • Potassium-dependent regulation:

    • Low external K+ concentrations (below 1 mM) typically induce kdpC expression

    • This regulation likely involves a two-component system similar to KdpDE in E. coli

    • Sensor kinase components respond to K+ limitation by phosphorylating response regulators

  • Plant environment influences:

    • Exposure to plant apoplastic fluid alters expression patterns of transport systems

    • Defense compounds and plant-derived signals may modulate kdpC expression

    • pH changes in the apoplast during infection affect ion transporter expression

  • Integration with virulence systems:

    • Gene expression during plant colonization shows coordination between metabolic systems and virulence factors

    • When P. syringae pv. phaseolicola exists as episomes, various genes including transport systems show altered expression profiles

    • Genomic island excision events can affect neighboring gene expression patterns

  • Stress responses:

    • Osmotic stress induces kdpC expression independent of direct K+ sensing

    • Temperature shifts may indirectly affect kdpC through global regulatory networks

    • Unlike phaseolotoxin expression, which is strongly temperature-regulated (optimal at 18-20°C), kdpC regulation appears more directly tied to ion availability

Transcriptional Architecture:

The kdpFABC operon in P. syringae pv. phaseolicola follows a similar organization to other Pseudomonas species, with expression likely controlled through:

  • A promoter region upstream of kdpF

  • Potential regulatory binding sites for response regulators

  • Possible integration with global stress response systems

Evidence from related bacteria suggests that cellular cyclic di-GMP levels may also influence expression of transport systems, with recent research in P. aeruginosa demonstrating links between c-di-GMP signaling networks and membrane protein expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.