Recombinant Pseudomonas syringae pv. phaseolicola Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Protein Identity and Function

The ArnE protein belongs to a family of membrane transporters responsible for flipping 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the bacterial inner membrane . This transporter activity is crucial for the incorporation of aminoarabinose modifications into bacterial lipopolysaccharide (LPS), which reduces the negative charge of the bacterial outer membrane and consequently decreases susceptibility to cationic antimicrobial peptides.

In Pseudomonas species, ArnE is part of the EamA-like transporter family, as evidenced by its conserved domain structure . The protein functions as a subunit of a larger flippase complex that facilitates the movement of specific lipid molecules across the membrane bilayer. This process is essential for membrane asymmetry and the proper organization of the bacterial cell envelope.

Genomic Context

The arnE gene typically exists within an operon along with other genes involved in LPS modification. This genetic organization ensures coordinated expression of the entire pathway responsible for aminoarabinose incorporation into LPS. In Pseudomonas protegens, the arnE gene is located on the chromosome at position 3432418-3432762 on the positive strand .

The genomic context of arnE reflects its functional integration within bacterial cell envelope biogenesis processes. While the exact genomic location in Pseudomonas syringae pv. phaseolicola may differ, the functional association with lipopolysaccharide modification is likely conserved across Pseudomonas species.

Recombinant Expression Systems

Recombinant expression of membrane proteins presents significant challenges due to their hydrophobic nature and requirements for proper membrane insertion. For experimental studies, ArnE proteins from various Pseudomonas species have been successfully expressed in Escherichia coli expression systems with affinity tags to facilitate purification.

A typical recombinant expression strategy for ArnE involves:

  1. Cloning the arnE coding sequence into an expression vector with an N-terminal or C-terminal affinity tag (commonly a His-tag)

  2. Transformation into an E. coli expression strain optimized for membrane protein production

  3. Induction of protein expression under controlled conditions

  4. Membrane isolation and detergent solubilization

  5. Affinity chromatography purification

For recombinant proteins similar to ArnE, the following expression and storage conditions have been reported:

ParameterCondition
Expression HostE. coli
Affinity TagHis-tag (typically N-terminal)
Protein FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Temperature-20°C/-80°C
Recommended ReconstitutionDeionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol

These parameters, documented for related flippase proteins, provide a framework for the recombinant production of Pseudomonas syringae pv. phaseolicola ArnE .

Role in Antimicrobial Resistance

The primary physiological significance of ArnE lies in its contribution to bacterial resistance against cationic antimicrobial peptides. By facilitating the incorporation of aminoarabinose into lipopolysaccharide, ArnE helps reduce the negative charge of the bacterial outer membrane, thereby decreasing the electrostatic attraction to positively charged antimicrobial peptides.

This mechanism represents a fundamental adaptive strategy that allows Pseudomonas species, including P. syringae pv. phaseolicola, to survive in hostile environments containing natural or synthetic antimicrobial compounds. The conservation of this mechanism across multiple Pseudomonas species underscores its evolutionary importance.

Membrane Biophysics and Lipid Asymmetry

Beyond antimicrobial resistance, ArnE contributes to the maintenance of membrane lipid asymmetry. As a flippase, it participates in the directional movement of specific lipids between membrane leaflets, which is essential for proper membrane organization and function.

The flippase activity of ArnE shares functional parallels with eukaryotic flippases, though the proteins are structurally distinct. In both cases, these transporters help establish and maintain the asymmetric distribution of phospholipids and glycolipids that defines functional biological membranes .

Antimicrobial Development

Research into ArnE function has significant implications for antimicrobial drug development. As bacteria increasingly develop resistance to conventional antibiotics, targeting the LPS modification pathways that involve ArnE represents a potential strategy for novel antimicrobial development.

Inhibitors that specifically target ArnE or other components of the aminoarabinose modification pathway could potentially restore bacterial susceptibility to existing antimicrobial peptides or conventional antibiotics, offering new avenues for combating resistant infections.

Biotechnological Applications

Beyond its relevance to antimicrobial research, recombinant ArnE has potential applications in membrane protein studies and biotechnology:

  1. As a model system for investigating membrane protein folding and assembly

  2. For structural studies of bacterial transporters

  3. In reconstituted membrane systems for biophysical research

  4. As a component in engineered lipid modification pathways

The availability of recombinant expression systems for ArnE proteins facilitates these diverse research applications by providing access to purified protein for in vitro and structural studies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; PSPPH_2807; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
arnE
Target Protein Sequence
MTWLMLLSACLLTCLGQIAQKYAVEGWRETFPGVLAALRSMWLWLAIACLGLGLLVWLLV LQRMDVGIAYPMLGLNFVLITLVGRYVFKEPVDPQHWLGIALILVGVFQLGRQA
Uniprot No.

Target Background

Function
This protein acts as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas syringae pv. phaseolicola and what is its significance in plant pathology?

Pseudomonas syringae pv. phaseolicola is a plant pathogenic bacterium that causes halo blight disease in beans (Phaseolus vulgaris). It belongs to the larger Pseudomonas syringae species complex, which comprises environmentally ubiquitous bacterial populations associated with diseases across numerous plant species . The pathogen synthesizes phaseolotoxin, a non-host-specific toxin that inhibits ornithine carbamoyltransferase in plants, disrupting the urea cycle and causing chlorosis (yellowing) in host tissues . Understanding this organism is critical for developing disease management strategies in agriculture and for using it as a model system to study plant-microbe interactions.

What is the predicted function of the arnE gene in Pseudomonas syringae pv. phaseolicola?

Based on comparative genomics and homology with arnE in other bacterial species, the Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE in P. syringae pv. phaseolicola likely functions as part of the arnBCADTEF operon involved in lipopolysaccharide (LPS) modification . Specifically, ArnE is predicted to work together with ArnF to form a flippase complex that translocates 4-amino-4-deoxy-L-arabinose (Ara4N) from the cytoplasmic to the periplasmic face of the inner membrane. This modification of LPS with Ara4N typically contributes to antimicrobial peptide resistance by reducing the negative charge of the bacterial outer membrane, which may be important for P. syringae survival in host plants or other environments.

How does horizontal gene transfer contribute to the evolution of Pseudomonas syringae pv. phaseolicola?

Horizontal gene transfer (HGT) plays a crucial role in the evolution of P. syringae pv. phaseolicola by facilitating the acquisition of virulence factors and adaptive traits . Studies have demonstrated that many virulence-associated genes in P. syringae, including toxin biosynthesis genes, have been acquired through HGT . For example, the argK gene (encoding a phaseolotoxin-resistant ornithine carbamoyltransferase) and phaseolotoxin biosynthesis genes have characteristics suggesting horizontal acquisition, such as lower G+C content compared to the rest of the genome . HGT events, mediated through plasmids, integrative and conjugative elements, and other mobile genetic elements, have contributed significantly to the emergence of pathogenic lineages and host specificity within the P. syringae complex .

How do genome-wide recombination events influence the emergence of hybrid pathogenic lineages in Pseudomonas syringae?

Genome-wide homologous recombination has been observed to create hybrid phylogenetic groups within the P. syringae complex . For instance, comparative genomic analyses have revealed a hybrid phylogenetic group among cucurbit strains collected across different geographical locations (Florida, Italy, Serbia, and France), which emerged through extensive recombination between phylogroups 2a and 2b . Functional analysis of these recombinant genomes indicates enrichment for recombination in pathways involved in ATP-dependent transport, amino acid metabolism, bacterial motility, and secretion systems . These recombination events can significantly accelerate adaptive evolution by combining beneficial alleles from different genetic backgrounds, potentially leading to enhanced virulence, host range expansion, or adaptation to new environmental niches. Research investigating the mechanistic basis of these recombination events could provide insights into the evolutionary dynamics of pathogen emergence.

What molecular and structural characteristics distinguish the arnE gene product in Pseudomonas syringae from homologous proteins in other bacterial species?

The arnE gene product in Pseudomonas syringae likely shares core structural features with homologs in other bacterial species while possessing species-specific adaptations. Comparative structural biology approaches would be necessary to elucidate these distinctions. Research questions in this area might explore:

  • Protein sequence conservation and divergence patterns across bacterial species

  • Structure-function relationships in the ArnE-ArnF flippase complex

  • Membrane topology and critical residues for flippase activity

  • Species-specific adaptations that might reflect different ecological pressures

These investigations would require techniques such as protein crystallography, cryo-electron microscopy, molecular dynamics simulations, and mutational analyses to fully characterize the structural and functional uniqueness of the P. syringae ArnE protein.

How does the expression of arnE correlate with antimicrobial resistance profiles and environmental adaptation in Pseudomonas syringae pv. phaseolicola?

The expression patterns of arnE and their correlation with antimicrobial resistance and environmental adaptation remain poorly characterized in P. syringae pv. phaseolicola. This represents an important research gap. In other bacterial species, the arnBCADTEF operon is typically regulated by two-component systems responding to environmental signals such as low Mg²⁺ or the presence of cationic antimicrobial peptides. Transcriptomic studies combined with phenotypic analyses could reveal whether arnE expression in P. syringae:

  • Is induced during plant colonization or infection

  • Responds to specific plant defense compounds

  • Contributes to survival under varying environmental conditions

  • Affects virulence or fitness in different host plants

Such studies would enhance our understanding of the ecological and pathological significance of LPS modifications in this important plant pathogen.

What are the optimal protocols for cloning and expressing recombinant arnE from Pseudomonas syringae pv. phaseolicola?

The cloning and expression of recombinant arnE from P. syringae pv. phaseolicola requires careful optimization due to several challenges: (1) membrane proteins are often difficult to express in functional form, (2) potential toxicity to expression hosts, and (3) the need to maintain proper folding and membrane insertion.

A recommended methodological approach would include:

  • Gene synthesis and vector design:

    • Codon optimization for the expression host (E. coli BL21(DE3), C41(DE3), or C43(DE3))

    • Addition of affinity tags (His6, FLAG, or Strep-tag II) at either N- or C-terminus

    • Inclusion of a protease cleavage site for tag removal

    • Use of vectors with tunable promoters (e.g., T7lac or araBAD)

  • Expression optimization:

    • Temperature screening (16°C, 25°C, 30°C, 37°C)

    • Inducer concentration titration

    • Growth media comparison (LB, TB, 2xYT with supplements)

    • Time-course analysis of expression

  • Membrane protein solubilization:

    • Detergent screening (DDM, LDAO, OG, FC-12)

    • Evaluation of solubilization efficiency and protein stability

This systematic approach maximizes the likelihood of obtaining functional recombinant ArnE protein for further structural and functional studies.

What techniques are most effective for investigating protein-protein interactions between ArnE and potential binding partners in Pseudomonas syringae?

Investigating protein-protein interactions involving membrane proteins like ArnE requires specialized approaches. The following techniques have proven most effective:

TechniqueAdvantagesLimitationsData Output
Bacterial Two-Hybrid (BACTH)Works in vivo, suitable for membrane proteinsLower sensitivity, potential false positivesBinary interaction data
Pull-down assays with recombinant proteinsDirect evidence of interaction, can identify binding domainsRequires purified proteins, may not capture weak/transient interactionsConfirmation of direct interactions
Co-immunoprecipitationCaptures interactions in native conditionsRequires specific antibodies or epitope tagsIdentifies interaction partners from cellular lysates
Bimolecular Fluorescence Complementation (BiFC)Visualizes interactions in situMay force interactions, irreversible complex formationSpatial information on interactions
Surface Plasmon Resonance (SPR)Quantitative binding kineticsTechnical challenges with membrane proteinsAssociation/dissociation constants

For ArnE, a combination approach starting with BACTH or BiFC to identify potential interaction partners (especially ArnF), followed by biochemical validation through pull-down assays and SPR for kinetic parameters, would provide comprehensive characterization of its protein interaction network.

How can mutagenesis approaches be applied to study structure-function relationships in the ArnE protein?

Systematic mutagenesis approaches are invaluable for dissecting structure-function relationships in membrane proteins like ArnE. A comprehensive strategy would include:

  • Alanine-scanning mutagenesis:

    • Systematically replace conserved residues with alanine

    • Focus on predicted transmembrane domains and cytoplasmic loops

    • Assess impact on protein stability, localization, and function

  • Cysteine-scanning mutagenesis and accessibility studies:

    • Introduce cysteine residues at specific positions

    • Use membrane-permeable and impermeable sulfhydryl reagents

    • Map topology and accessibility of different protein regions

  • Domain swapping with homologous proteins:

    • Create chimeric proteins with ArnE homologs from other bacteria

    • Identify domains responsible for species-specific functions

    • Assess impact on substrate specificity or interaction partners

  • Functional assays for mutant evaluation:

    • Lipopolysaccharide profile analysis by mass spectrometry

    • Antimicrobial peptide resistance testing

    • In vitro flippase activity assays using fluorescent lipid analogs

    • Complementation of arnE-deficient strains

This systematic approach would generate a detailed map of functionally important residues and domains in the ArnE protein, providing insights into its mechanism of action.

How should researchers analyze evolutionary patterns of arnE in the context of Pseudomonas syringae genomic diversity?

Evolutionary analysis of arnE within the P. syringae complex requires a multi-faceted approach:

  • Phylogenetic analysis:

    • Construct maximum likelihood trees of arnE sequences

    • Compare with core genome phylogeny to detect horizontal gene transfer

    • Calculate selection pressures (dN/dS ratios) across different lineages

  • Synteny analysis:

    • Examine conservation of the genetic context surrounding arnE

    • Identify co-evolving genes within the LPS modification pathway

    • Detect genomic islands or mobile genetic elements associated with arnE

  • Population genetics approaches:

    • Calculate nucleotide diversity (π) and Tajima's D to detect selection

    • Perform McDonald-Kreitman tests to distinguish between adaptive and neutral evolution

    • Use sliding window analyses to identify regions under different selective pressures

  • Comparative analysis across pathovars:

    • Correlate arnE sequence variants with host specificity

    • Examine potential co-evolution with host resistance mechanisms

    • Identify lineage-specific patterns of conservation or diversification

This comprehensive analytical framework would reveal how arnE has evolved within the P. syringae complex and whether its evolutionary trajectory correlates with pathogenicity, host range, or environmental adaptation .

What statistical approaches are most appropriate for analyzing differential expression of arnE under various experimental conditions?

When analyzing differential expression of arnE across experimental conditions, researchers should consider:

  • Experimental design considerations:

    • Include sufficient biological replicates (minimum n=3)

    • Account for batch effects and potential confounding variables

    • Include appropriate housekeeping genes as internal controls

  • Statistical methods for RNA-Seq data:

    • Normalize count data appropriately (e.g., TPM, RPKM, or DESeq2 normalization)

    • Apply negative binomial models (e.g., DESeq2, edgeR) for count data

    • Control for multiple testing using Benjamini-Hochberg procedure

    • Consider time-course analysis methods for temporal expression studies

  • Statistical methods for qRT-PCR data:

    • Apply the 2^(-ΔΔCT) method with appropriate reference genes

    • Validate reference gene stability using geNorm or NormFinder

    • Use ANOVA with post-hoc tests for multi-condition comparisons

    • Consider non-parametric alternatives if assumptions are violated

  • Visualization and interpretation:

    • Create volcano plots highlighting significant changes

    • Use heatmaps to visualize patterns across conditions

    • Perform clustering analyses to identify co-regulated genes

    • Integrate with other omics data for systems-level interpretation

These approaches ensure robust statistical analysis of arnE expression patterns, facilitating the identification of regulatory mechanisms and environmental triggers controlling its expression.

How can researchers integrate structural predictions with functional data to develop comprehensive models of ArnE activity?

Integrating structural predictions with functional data requires a systematic approach:

  • Structural prediction pipeline:

    • Generate transmembrane topology predictions using multiple algorithms (TMHMM, TOPCONS, Phobius)

    • Apply homology modeling using related flippase structures as templates

    • Employ ab initio modeling for regions lacking templates

    • Validate predicted structures through molecular dynamics simulations

  • Functional data collection:

    • Characterize phenotypes of wild-type and mutant strains

    • Measure flippase activity using fluorescent lipid analogs

    • Determine lipid specificities through competition assays

    • Map interaction interfaces using crosslinking studies

  • Integration methods:

    • Map functional residues onto predicted structures

    • Use structure-guided mutagenesis to test model predictions

    • Develop mechanism hypotheses based on structural features

    • Refine models iteratively based on experimental feedback

  • Computational validation:

    • Perform molecular docking of substrate molecules

    • Simulate conformational changes during flipping mechanism

    • Calculate energetics of substrate binding and translocation

    • Compare predicted and experimentally determined kinetic parameters

This integrated approach yields testable models of ArnE function that can guide further experimental investigations and potentially inform the development of inhibitors or other applications.

What emerging technologies could advance our understanding of arnE function in Pseudomonas syringae pv. phaseolicola?

Several emerging technologies hold promise for deepening our understanding of arnE function:

  • Single-cell technologies:

    • Single-cell RNA-seq to capture expression heterogeneity

    • Time-lapse microscopy with fluorescent reporters to track dynamics

    • Single-cell proteomics to correlate transcript and protein levels

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for membrane protein structures

    • Solid-state NMR for dynamics in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes

  • Genome editing technologies:

    • CRISPR-Cas9 for precise genomic modifications

    • Base editors for introducing specific mutations

    • CRISPRi/CRISPRa for reversible gene modulation

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Flux analysis of lipid transport and modification

    • Network modeling of LPS modification pathways

These technologies, particularly when used in combination, could provide unprecedented insights into the molecular mechanisms, regulation, and physiological roles of arnE in P. syringae pv. phaseolicola.

How might comparative studies across different Pseudomonas species enhance our understanding of evolutionary patterns in LPS modification systems?

Comparative studies across Pseudomonas species would significantly advance our understanding of LPS modification systems through:

  • Phylogenomic approaches:

    • Reconstruction of the evolutionary history of the arn operon

    • Identification of gene gain, loss, and duplication events

    • Detection of co-evolution between components of LPS modification pathways

    • Correlation with ecological niches and pathogenicity

  • Functional comparative genomics:

    • Characterization of species-specific adaptations in ArnE function

    • Identification of lineage-specific regulatory mechanisms

    • Assessment of substrate specificities across diverse species

    • Correlation of sequence variations with functional differences

  • Experimental evolution studies:

    • Laboratory evolution under antimicrobial peptide selection

    • Tracking molecular changes in the arn operon during adaptation

    • Testing fitness costs of LPS modifications in different environments

    • Monitoring horizontal transfer rates of LPS modification genes

These comparative approaches would reveal how environmental pressures have shaped the evolution of LPS modification systems and potentially identify novel mechanisms of antimicrobial resistance or host adaptation that could be targets for intervention strategies .

What research gaps remain in understanding the role of arnE in Pseudomonas syringae virulence and environmental adaptation?

Despite advances in our understanding of P. syringae pathogenicity, several critical research gaps remain regarding arnE:

  • Regulatory networks:

    • How is arnE expression regulated in response to environmental signals?

    • Which transcription factors and two-component systems control the arn operon?

    • Does expression correlate with specific stages of plant infection?

  • Role in plant-microbe interactions:

    • Does ArnE-mediated LPS modification affect recognition by plant immune receptors?

    • How does it contribute to survival in the plant apoplast?

    • Is there variation in arnE function across strains with different host ranges?

  • Ecological significance:

    • What is the role of ArnE in environmental persistence outside hosts?

    • How does it contribute to survival under abiotic stresses?

    • Does it affect interactions with other microorganisms in the phyllosphere?

  • Structural biology:

    • What is the high-resolution structure of the ArnE-ArnF complex?

    • How does substrate binding trigger conformational changes?

    • Which residues determine substrate specificity?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.