Recombinant Pseudomonas syringae pv. phaseolicola Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
arnF; PSPPH_2808; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
arnF
Target Protein Sequence
MCALTSVALVSSAQLGMRWSMSRLPSPGQWLDLQDIGQVQSSAIAVICASITAYALSMLF WLLALRDLPLSRAYSLLSISYALVYTLAATLPFFHETFTVSKTVGVTLIVAGVLTINLRR ISSPSLQDLSHENQRFR
Uniprot No.

Target Background

Function
This protein functions as a flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnF and what is its primary function in Pseudomonas syringae?

ArnF (probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit) functions as a membrane protein involved in lipopolysaccharide modification pathways. In Pseudomonas syringae, the ArnF protein serves as a subunit of the flippase complex responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the cytoplasmic membrane. This modification pathway contributes to antimicrobial resistance mechanisms by altering the cell surface charge, potentially reducing the binding of cationic antimicrobial compounds .

The full-length protein in P. syringae pv. phaseolicola consists of 137 amino acids, making it a relatively small membrane protein. Recombinant versions typically include tags such as His-tag to facilitate purification and downstream applications . Understanding this protein's function provides insights into bacterial membrane biology and potential antimicrobial targets.

How does ArnF expression vary across different growth phases in Pseudomonas?

While the search results don't provide specific data on ArnF expression across growth phases in Pseudomonas syringae, general transcriptomic studies of P. syringae have demonstrated that virulence factors show significant differential expression between growth phases. For example, in P. syringae strain MB03, multiple virulence factors including membrane proteins showed upregulated expression when stationary phase cells interacted with Caenorhabditis elegans compared to logarithmic phase cells .

For experimental design, researchers should consider:

Growth PhaseRecommended Sampling PointsExpected Expression Patterns
Lag PhaseOD₆₀₀ < 0.2Baseline expression levels
Log PhaseOD₆₀₀ 0.4-0.8May show initial induction
Early StationaryOD₆₀₀ 1.0-1.5Potential upregulation in response to nutrient limitation
Late Stationary> 24 hours post-inoculationHighest expression if involved in stress response

Monitoring ArnF expression through quantitative PCR or proteomics across these growth phases would provide valuable insights into its regulation and potential role in different physiological states.

What expression systems are optimal for producing functional recombinant ArnF?

Expression SystemAdvantagesLimitationsRecommended Use Cases
E. coli BL21(DE3)High yield, easy handling, well-established protocolsMay form inclusion bodies, lack post-translational modificationsInitial protein production, structural studies
E. coli C41/C43Specialized for membrane proteins, reduces toxicityLower yields than standard strainsWhen standard strains fail to express ArnF
Pseudomonas-basedNative post-translational modifications, proper foldingMore complex handling, lower yieldsFunctional studies requiring native modifications
Cell-free systemsAvoids toxicity issues, rapid expressionHigher cost, potential folding issuesQuick screening of mutants, toxic variants

For optimal results with E. coli expression systems, induction conditions should be optimized by testing various temperatures (16-30°C), IPTG concentrations (0.1-1.0 mM), and induction durations (4-24 hours). Lower temperatures (16-18°C) often improve the folding of membrane proteins like ArnF .

What purification protocols yield the highest activity for recombinant ArnF?

Purification of recombinant ArnF requires careful consideration of its membrane protein nature. Based on available information for His-tagged recombinant ArnF, the following protocol outline is recommended:

  • Cell Lysis and Membrane Fraction Isolation:

    • Resuspend cells in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Disrupt cells via sonication or French press

    • Centrifuge at 10,000×g to remove cell debris

    • Ultracentrifuge supernatant at 100,000×g to isolate membrane fraction

  • Membrane Protein Solubilization:

    • Resuspend membrane pellet in solubilization buffer containing:

      • 50 mM Tris-HCl pH 8.0

      • 150 mM NaCl

      • 1% n-Dodecyl β-D-maltoside (DDM) or 1% n-Octyl-β-D-glucopyranoside (OG)

    • Incubate with gentle rotation at 4°C for 1-2 hours

  • Affinity Chromatography:

    • Apply solubilized fraction to Ni-NTA column equilibrated with buffer containing:

      • 50 mM Tris-HCl pH 8.0

      • 150 mM NaCl

      • 0.1% detergent

      • 20 mM imidazole

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute with 250-300 mM imidazole

  • Buffer Exchange and Storage:

    • Exchange into storage buffer containing:

      • 50 mM Tris-HCl pH 8.0

      • 150 mM NaCl

      • 0.05% detergent

      • 10% glycerol

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

For long-term storage, lyophilization in the presence of 6% trehalose has been reported to maintain protein stability, with reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL as needed .

How can ArnF activity be accurately measured in vitro?

Measuring the flippase activity of ArnF presents significant challenges due to its membrane-embedded nature and the complexity of its substrate. The following methodological approaches can be employed:

  • Reconstitution in Liposomes:

    • Prepare liposomes using E. coli polar lipid extract

    • Incorporate purified ArnF into liposomes via detergent removal

    • Load fluorescently labeled aminoarabinose analogs inside liposomes

    • Measure translocation using fluorescence quenching assays

  • Coupled Enzymatic Assays:

    • Reconstitute the complete Arn pathway in proteoliposomes

    • Monitor substrate consumption or product formation using HPLC or mass spectrometry

    • Calculate ArnF activity based on the rate of substrate translocation

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label the substrate with a fluorescent donor

    • Label ArnF with an acceptor fluorophore

    • Monitor FRET changes during substrate binding and translocation

Each approach has specific advantages and limitations, so combining multiple methods is recommended for comprehensive activity characterization.

How can recombineering approaches be used to study ArnF function in Pseudomonas syringae?

Recombineering techniques provide powerful tools for genetic manipulation of ArnF in Pseudomonas syringae. The RecT/RecE homologs identified in P. syringae pv. syringae B728a enable efficient homologous recombination between genomic loci and linear DNA introduced by electroporation . This system can be applied to study ArnF through:

  • Gene Disruption:

    • Design linear DNA fragments with homology arms flanking the arnF gene

    • Replace arnF with an antibiotic resistance cassette

    • Confirm disruption through PCR and phenotypic analysis

  • Point Mutations:

    • Introduce single-nucleotide changes to create specific amino acid substitutions

    • Use single-stranded DNA oligonucleotides with RecT expression

    • Develop a screening method to identify successful recombinants

  • Domain Swapping:

    • Replace specific domains of ArnF with corresponding regions from homologs

    • Evaluate functional changes to identify critical regions

For successful recombineering in P. syringae, the following protocol is recommended:

  • Express RecT (for single-stranded DNA) or both RecE and RecT (for double-stranded DNA) from plasmids

  • Prepare electrocompetent cells at mid-log phase (OD₆₀₀ ~0.4-0.6)

  • Introduce 50-100 ng of linear DNA or 0.1-1 μg of ssDNA

  • Electroporate at 2.5 kV, 25 μF, 200 Ω

  • Recover in rich medium for 2-3 hours before selective plating

This approach allows for precise genetic manipulation of arnF without the limitations of traditional mutagenesis methods.

What structural features distinguish ArnF from other membrane flippases, and how can they be exploited in research?

While detailed structural information specific to P. syringae ArnF is limited in the search results, comparative analysis with other flippase proteins reveals several distinctive features that can be exploited for research:

  • Transmembrane Topology:

    • ArnF contains multiple predicted transmembrane domains

    • The organization of these domains creates a hydrophilic channel for substrate passage

    • Research opportunity: Use cysteine scanning mutagenesis to map the translocation pathway

  • Substrate Specificity Determinants:

    • Specific residues within transmembrane domains likely confer substrate selectivity

    • Research opportunity: Perform alanine scanning of conserved residues to identify critical interaction sites

  • Oligomeric State:

    • ArnF likely functions as part of a multi-subunit complex

    • Research opportunity: Use crosslinking studies and blue native PAGE to determine native oligomeric state

To leverage these structural features in research, the following experimental approaches are particularly valuable:

ApproachApplication to ArnFExpected Outcome
Site-directed mutagenesisTarget conserved residues in predicted substrate-binding regionsIdentification of critical residues for function
Chimeric proteinsExchange domains between ArnF and related flippasesDetermination of specificity-conferring regions
Computational modelingPredict substrate docking and conformational changesHypothesis generation for experimental validation
Accessibility studiesIntroduce reporter groups at specific positionsMapping of membrane topology and conformational changes

These approaches can provide insights into the molecular mechanism of ArnF function and its potential as an antimicrobial target.

How does ArnF contribute to antimicrobial resistance in Pseudomonas syringae?

ArnF contributes to antimicrobial resistance in Pseudomonas syringae through its role in lipopolysaccharide (LPS) modification. As a component of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, ArnF facilitates the translocation of aminoarabinose residues that are subsequently incorporated into lipid A. This modification reduces the negative charge of the bacterial outer membrane, decreasing the binding affinity of cationic antimicrobial peptides and certain antibiotics.

The key resistance mechanisms involving ArnF include:

  • Altered Surface Charge:

    • Aminoarabinose addition neutralizes negative phosphate groups

    • Reduces electrostatic attraction of cationic antimicrobials

  • Modified LPS Packing:

    • Changes in lipid A structure affect membrane permeability

    • May reduce penetration of hydrophobic antimicrobials

  • Regulatory Cross-talk:

    • The Arn pathway is often co-regulated with other resistance mechanisms

    • May be part of a broader adaptive response to environmental stresses

To study ArnF's role in antimicrobial resistance, researchers can employ the following experimental design:

ExperimentMethodologyControlsExpected Outcomes
Gene knockout studiesGenerate arnF deletion mutants via recombineering Wild-type and complemented strainsIncreased susceptibility to cationic antimicrobials
Overexpression analysisExpress arnF from inducible promotersEmpty vector controlsEnhanced resistance to specific antimicrobials
Lipid A analysisMass spectrometry of extracted lipid ASamples with/without antimicrobial challengeQuantification of aminoarabinose modification
Membrane permeability assaysFluorescent dye uptake (e.g., NPN)Known permeability mutantsCorrelation between ArnF expression and membrane barrier function

Understanding ArnF's contribution to antimicrobial resistance may reveal new strategies for overcoming resistance mechanisms in plant pathogens.

What are common pitfalls in recombinant ArnF expression and how can they be addressed?

Researchers working with recombinant ArnF commonly encounter several challenges that can significantly impact protein yield and quality. The following table outlines these issues and provides practical solutions:

ChallengePotential CausesSolutions
Poor expression yieldCodon bias, toxicity to host, promoter leakageUse codon-optimized gene, tight expression control, specialized host strains (C41/C43)
Inclusion body formationRapid expression rate, improper foldingLower induction temperature (16-18°C), reduce IPTG concentration (0.1-0.2 mM), add folding enhancers (glycerol, sorbitol)
Proteolytic degradationRecognition by host proteasesAdd protease inhibitors, use protease-deficient strains, optimize harvest timing
Low solubilityHydrophobic transmembrane domainsScreen multiple detergents (DDM, LDAO, FC-12), optimize detergent:protein ratio
Loss of activity during purificationDetergent effects, removal of essential lipidsSupplement with E. coli lipid extract, use milder purification conditions
Protein aggregation during storageFreeze-thaw damage, detergent precipitationStore with glycerol (10-20%) and trehalose (6%), avoid repeated freeze-thaw cycles

For optimal storage and handling of purified ArnF, maintaining the protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended. For long-term storage, adding glycerol to a final concentration of 50% and storing at -80°C in small aliquots minimizes activity loss .

How can fluorescent labeling techniques be optimized for studying ArnF localization and dynamics?

Fluorescent labeling provides valuable insights into ArnF localization, dynamics, and interactions within bacterial membranes. While the search results don't provide specific information about fluorescent labeling of ArnF, they do mention the use of RFP expression in Pseudomonas syringae for visualization studies . Based on this information and general principles of membrane protein labeling, the following approaches are recommended:

  • Fusion Protein Approaches:

    • C-terminal fusions are generally preferred to avoid disrupting signal sequences

    • Smaller fluorescent proteins (msfGFP, mNeonGreen) minimize folding interference

    • Include flexible linkers (GGGGS)₃ between ArnF and the fluorescent tag

  • Site-Specific Labeling:

    • Introduce unique cysteines at non-essential positions

    • Label with thiol-reactive fluorophores (Alexa Fluor maleimides)

    • Control experiments with unlabeled protein are essential

  • Click Chemistry:

    • Incorporate unnatural amino acids (p-azidophenylalanine)

    • Label with alkyne-functionalized fluorophores via copper-catalyzed click chemistry

    • Allows for pulse-chase experiments to study protein turnover

The following protocol outline is recommended for optimal fluorescent imaging of ArnF:

  • Transform Pseudomonas with fluorescent ArnF constructs or express in heterologous systems

  • Grow cultures to appropriate phase (consider testing multiple growth stages)

  • For fixed cell imaging:

    • Fix with 4% paraformaldehyde (10 minutes, room temperature)

    • Wash three times with PBS

    • Mount on poly-L-lysine coated slides

  • For live cell imaging:

    • Concentrate cells by gentle centrifugation

    • Mount on agarose pads (1% agarose in growth medium)

    • Use minimal light exposure to prevent photobleaching

Time-lapse microscopy can reveal dynamic behaviors including membrane domain localization and response to environmental stimuli.

What controls are essential when studying the impact of ArnF mutations on bacterial phenotypes?

  • Genetic Controls:

    • Wild-type parent strain (positive control)

    • Complete arnF deletion mutant (negative control)

    • Complemented mutant (arnF gene reintroduced on plasmid)

    • Empty vector control for complementation studies

    • Site-directed mutations in non-conserved residues (specificity control)

  • Expression Controls:

    • qRT-PCR to verify transcript levels

    • Western blotting to confirm protein expression

    • Growth curves to identify potential fitness costs

  • Phenotypic Controls:

    • Known antimicrobial resistance mutants

    • Treatment with specific inhibitors of related pathways

    • Environmental conditions that don't activate the Arn pathway

When using recombineering approaches to generate mutations, special attention should be paid to potential polar effects on adjacent genes. The RecT/RecE system from Pseudomonas syringae allows for precise genetic modifications that minimize such effects . Additionally, researchers should verify that any observed phenotypes are specifically linked to ArnF function rather than general membrane disruption through appropriate membrane integrity assays.

How might structural studies of ArnF inform antimicrobial development strategies?

Detailed structural characterization of ArnF presents promising opportunities for antimicrobial development. While current structural information is limited to computational models like those available for the E. coli homolog , pursuing experimental structures would significantly advance therapeutic strategies:

  • Structure-Based Inhibitor Design:

    • High-resolution structures would reveal potential binding pockets

    • Virtual screening against these pockets could identify candidate inhibitors

    • Fragment-based approaches could develop inhibitors specific to ArnF

  • Rational Design of ArnF Inhibitors:

    • Targeting the substrate-binding site could directly block flippase activity

    • Interfering with protein-protein interactions within the Arn complex

    • Designing substrate analogs that competitively inhibit natural substrate binding

  • Combination Therapy Approaches:

    • ArnF inhibitors could sensitize bacteria to existing antimicrobials

    • Targeting multiple LPS modification pathways simultaneously

    • Developing adjuvants that enhance antimicrobial peptide effectiveness

The following research pipeline is proposed for structure-based antimicrobial development:

PhaseMethodologyExpected OutcomesTimeline
Structural determinationX-ray crystallography, cryo-EM, or NMR of detergent-solubilized or nanodisc-reconstituted ArnFHigh-resolution structure revealing binding sites and conformational states1-2 years
Computational screeningVirtual docking of compound libraries against identified pockets100-1000 candidate compounds for experimental testing6-12 months
In vitro validationBinding assays, activity inhibition assays5-10 lead compounds with demonstrable activity1 year
Resistance mechanism studiesSelection of resistant mutants, whole genome sequencingUnderstanding of potential resistance mechanisms6 months
Preclinical developmentOptimization of pharmacokinetics, assessment of toxicity1-3 optimized compounds for further development1-2 years

This research direction shows particular promise for developing narrow-spectrum antibiotics targeting specific plant pathogens, potentially reducing agricultural losses while minimizing environmental impact.

What novel approaches could enhance our understanding of ArnF's role in Pseudomonas syringae pathogenicity?

Innovative experimental approaches could significantly advance our understanding of ArnF's contribution to P. syringae pathogenicity. Building upon recent findings about P. syringae pathogenicity mechanisms , the following novel approaches are promising:

  • Single-Cell Level Analysis:

    • Microfluidic devices to track individual bacterial cells during infection

    • Time-lapse fluorescence microscopy of fluorescently-tagged ArnF during host interaction

    • Correlative light and electron microscopy to link ArnF localization with membrane ultrastructure

  • Host-Pathogen Interface Studies:

    • Plant infection models with real-time imaging capabilities

    • Biosensors to detect changes in membrane composition during infection

    • Tissue-specific analysis of bacterial gene expression in planta

  • Systems Biology Approaches:

    • Network analysis integrating transcriptomics, proteomics, and metabolomics data

    • Global genetic interaction mapping using CRISPRi libraries

    • Machine learning to identify patterns in pathogenicity data

  • Evolutionary Perspectives:

    • Comparative genomics across Pseudomonas species with varying pathogenicity

    • Experimental evolution under antimicrobial pressure

    • Phylogenetic analysis of ArnF and related proteins across bacterial species

The following experimental design would be particularly informative:

Experimental ApproachMethodologyExpected Insights
Dual RNA-seq during infectionSimultaneous profiling of host and pathogen transcriptomesCo-regulated pathways, temporal dynamics of arnF expression
In planta bacterial proteomicsIsolation of bacteria from infected tissue, mass spectrometryPost-translational modifications, protein abundance changes
CRISPR interference screeningGenome-wide knockdown library, infection assaysGenes that genetically interact with arnF
Lipidome analysisComprehensive profiling of membrane lipids during infectionChanges in membrane composition linked to ArnF activity

These approaches would provide a more comprehensive understanding of ArnF's role within the broader context of Pseudomonas pathogenicity mechanisms and potentially reveal new targets for intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.