Recombinant Pseudomonas syringae pv. phaseolicola Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; PSPPH_0370; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
ubiB
Target Protein Sequence
MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWWMLAVRFVLPWRWLPRRKSELSRGVRFR LALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQQVAINLIEEQLGARIC DVFSRFDETPLASASVAQVHAACLKTGEEVVVKVVRPGLKPVIGQDLAWLFILARMAERV SADARLLHPVQVVMDYEKTIYDELDLLREAANSSQLRRNFEGSDLLYVPQVYWDWCRPKV LVMERIYGLQVTDMAGLADQRTDMKLLAERGVEIFFTQIFRDSFFHADMHPGNIFVSTVN PWSPKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPAETKLNEFE AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY PDLDLWSTAQPYLERWMRERVSPKTLFGNLQSQVEQLPHIAGMTRDLLERMSRPHASDPP RPWHERKDEPVLRLIGAALLVGGAIQGWVMSEAATQLLTLTAWPAAIMLIAGLYLIVRR
Uniprot No.

Target Background

Function
This protein likely functions as a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its role in Pseudomonas syringae pv. phaseolicola?

UbiB is a protein involved in the biosynthesis of ubiquinone (coenzyme Q), an essential component of the electron transport chain in bacterial respiration. In Pseudomonas syringae pv. phaseolicola, UbiB functions as an ATPase within the ubiquinone biosynthesis pathway . This bacterium, which causes halo blight in common beans (Phaseolus vulgaris), requires efficient energy metabolism to support its pathogenic lifestyle in plant tissues .

The ubiquinone biosynthesis pathway is particularly important for P. syringae pv. phaseolicola as it enables the bacterium to generate energy through aerobic respiration. This supports various metabolic processes necessary for survival in both environmental and host conditions. The pathway exists in both oxygen-dependent and oxygen-independent forms, allowing the bacterium to adapt to different oxygen availability in various microenvironments within plant tissues .

Efficient energy production through the electron transport chain supports the expression of virulence factors and the production of phytotoxins that contribute to the characteristic water-soaked lesions and chlorotic halos on infected bean plants .

What methods are used to identify and characterize the ubiB gene in Pseudomonas syringae pv. phaseolicola?

Researchers employ multiple complementary approaches to identify and characterize the ubiB gene in Pseudomonas syringae pv. phaseolicola:

Genomic Analysis:

  • Whole genome sequencing of P. syringae pv. phaseolicola strains, followed by comparative genomics with related Pseudomonas species

  • Bioinformatic analysis using tools that identify conserved domains characteristic of ubiquinone biosynthesis proteins

  • PCR amplification of the ubiB gene using primers designed from conserved regions, followed by sequencing

Functional Characterization:

  • Construction of ubiB knockout mutants via homologous recombination or transposon mutagenesis (similar to the technique used for rulB in study )

  • Complementation studies with recombinant ubiB to verify gene function

  • Analysis of ubiquinone production in wild-type versus mutant strains using high-performance liquid chromatography (HPLC)

Expression Analysis:

  • Quantitative PCR (qPCR) to measure ubiB expression under different environmental conditions

  • Transcriptional fusion reporters (similar to the rulAB::inaZ fusion described in ) to monitor gene expression in response to environmental stimuli

  • RNA-seq analysis to determine ubiB expression in the context of the whole transcriptome

These methodologies help researchers understand the regulation, expression patterns, and functional importance of the ubiB gene in P. syringae pv. phaseolicola, providing insights into its role in bacterial metabolism and potentially in pathogenesis.

How does UbiB contribute to ubiquinone biosynthesis in bacteria?

UbiB contributes to ubiquinone biosynthesis in bacteria through its ATPase activity, which provides energy for specific steps in the biosynthetic pathway . The precise biochemical mechanisms involve:

ATP-Dependent Reactions:

  • UbiB hydrolyzes ATP to power energetically unfavorable reactions in the ubiquinone biosynthesis pathway

  • This ATPase activity may be particularly important for hydroxylation reactions in the absence of oxygen

Protein Complex Formation:

  • UbiB functions as part of a multiprotein ubiquinone biosynthesis complex

  • Studies in related systems show that proteins like UbiJ and UbiK belong to this complex , suggesting UbiB likely interacts with multiple partner proteins

Pathway Regulation:

  • The ATPase activity of UbiB may serve as a regulatory checkpoint in the ubiquinone biosynthesis pathway

  • UbiB activity could be modulated in response to cellular energy status or environmental conditions

A methodological approach to studying UbiB's contribution includes:

  • Purification of recombinant UbiB protein expressed in E. coli expression systems

  • In vitro ATPase activity assays using colorimetric detection of released phosphate

  • Analysis of ubiquinone intermediate accumulation in ubiB mutants using mass spectrometry

  • Protein-protein interaction studies using pull-down assays, yeast two-hybrid, or bacterial two-hybrid systems

These techniques reveal how UbiB integrates into the complex enzymatic machinery required for ubiquinone production, which is essential for bacterial energy metabolism across varying oxygen conditions .

What growth conditions and experimental systems are optimal for expressing recombinant UbiB?

Optimal conditions for expressing recombinant UbiB from Pseudomonas syringae pv. phaseolicola require careful consideration of multiple factors:

Expression Systems:

  • E. coli BL21(DE3) or similar strains designed for recombinant protein expression

  • Alternative hosts such as Pseudomonas fluorescens may provide a more native-like environment for proper folding

  • Cell-free protein synthesis systems for proteins that may be toxic when overexpressed

Growth Parameters:

  • Temperature: Lower temperatures (16-25°C) often yield better results for soluble protein expression than standard 37°C incubation

  • Media composition: Rich media (LB) for initial testing; minimal media with controlled carbon sources for metabolic studies

  • Oxygen levels: Given UbiB's role in ubiquinone biosynthesis, expression under controlled oxygen conditions (similar to conditions described in ) may be important

Expression Optimization:

ParameterStandard ConditionOptimization Strategy
Inducer concentration0.5-1.0 mM IPTGTitration from 0.01-1.0 mM IPTG
Induction timeMid-log phaseEarly, mid, or late log phase
Post-induction duration4-6 hoursTest 2-24 hours at reduced temperatures
Media supplementsNoneAddition of ATP, Mg²⁺, Fe²⁺ cofactors

Protein Solubility Enhancement:

  • Fusion tags: MBP, SUMO, or GST tags to improve solubility

  • Co-expression with chaperones such as GroEL/GroES

  • Addition of mild detergents during cell lysis to extract membrane-associated fractions

When evaluating expression conditions, researchers should monitor both protein yield and enzymatic activity, as high-yield conditions may not always preserve optimal protein folding and function. Activity assays measuring ATPase function provide the most relevant metric of successful expression .

What analytical techniques are used to assess UbiB protein purity and activity?

Multiple analytical techniques are employed to evaluate both the purity and functional activity of recombinant UbiB protein:

Purity Assessment:

  • SDS-PAGE with Coomassie or silver staining for visualizing protein bands and assessing relative purity

  • Western blotting using anti-His tag or specific anti-UbiB antibodies for identity confirmation

  • Size exclusion chromatography to analyze oligomeric state and homogeneity

  • Mass spectrometry for accurate molecular weight determination and detection of post-translational modifications

Activity Assays:

  • ATPase activity measurement using:

    • Malachite green phosphate detection assay

    • Coupled enzymatic assays with pyruvate kinase and lactate dehydrogenase

    • Radioactive [γ-³²P]ATP hydrolysis assays for high sensitivity

Structural Analysis:

  • Circular dichroism spectroscopy to evaluate secondary structure content

  • Dynamic light scattering to assess protein monodispersity

  • Thermal shift assays to determine protein stability under various buffer conditions

  • Limited proteolysis to identify stable domains and flexible regions

Functional Validation:

  • Complementation assays in ubiB-deficient bacterial strains

  • In vitro reconstitution of ubiquinone biosynthesis with purified components

  • Protein-protein interaction studies with other ubiquinone biosynthesis complex components

An integrated approach combining these techniques provides comprehensive characterization of UbiB's biochemical properties. When assessing enzymatic activity, it's crucial to optimize assay conditions including pH, temperature, and cofactor concentrations to match the physiological environment of P. syringae pv. phaseolicola, which typically grows at 25-30°C .

How does UbiB function within the oxygen-independent ubiquinone biosynthesis pathway?

UbiB plays a specialized role in the oxygen-independent ubiquinone biosynthesis pathway, which represents an adaptation allowing bacteria to maintain energy metabolism under anaerobic or microaerobic conditions:

Oxygen-Independent Hydroxylation:

  • While traditional ubiquinone biosynthesis requires O₂ as a co-substrate for hydroxylation reactions, the O₂-independent pathway employs alternative mechanisms

  • UbiB's ATPase activity likely provides energy for these alternative hydroxylation reactions in the absence of oxygen

  • The ATP hydrolysis by UbiB may facilitate electron transfer necessary for hydroxylation without molecular oxygen

Interaction with Fe-S Cluster Proteins:

  • Research on related O₂-independent systems reveals that proteins like UbiU and UbiV form heterodimers containing 4Fe-4S clusters essential for hydroxylation reactions without oxygen

  • UbiB might functionally interact with these Fe-S cluster proteins or similar components in P. syringae

  • Methodological approaches to study these interactions include:

    • Co-immunoprecipitation with tagged UbiB followed by mass spectrometry

    • Bacterial two-hybrid screening

    • Cross-linking mass spectrometry to identify interaction interfaces

Regulatory Role in Pathway Switching:

  • UbiB may function as a regulatory switch between O₂-dependent and O₂-independent ubiquinone biosynthesis pathways

  • Expression analysis under varying oxygen concentrations would reveal whether ubiB is differentially regulated

  • Experimental approaches could include:

    • Transcriptomics comparing aerobic vs. anaerobic conditions

    • Promoter-reporter fusions to monitor real-time expression changes

    • Chromatin immunoprecipitation to identify regulatory proteins controlling ubiB expression

This oxygen-independent pathway represents a critical adaptation for P. syringae pv. phaseolicola, allowing the bacterium to colonize plant environments with fluctuating oxygen levels, similar to how other bacteria optimize metabolism across the entire O₂ range .

What structural and functional domains characterize the UbiB protein?

UbiB protein contains several characteristic domains and structural features that define its function within the ubiquinone biosynthesis pathway:

Predicted Structural Elements:

  • N-terminal nucleotide-binding domain with Walker A and Walker B motifs typical of ATPases

  • C-terminal domain likely involved in protein-protein interactions within the ubiquinone biosynthesis complex

  • Potential membrane-association regions, as ubiquinone biosynthesis occurs at the membrane interface

Functional Domains:

DomainAmino Acid PositionFunction
Walker A motif~50-60*ATP binding (GxxGxGKT/S consensus)
Walker B motif~170-180*Mg²⁺ coordination and ATP hydrolysis (hhhhDE consensus)
Substrate recognition domain~200-270*Binding of ubiquinone precursors
Protein interaction interface~300-350*Association with other complex components

*Positions are approximate and would need verification for P. syringae pv. phaseolicola UbiB specifically

Experimental Approaches for Structural Characterization:

  • X-ray crystallography or cryo-electron microscopy of purified UbiB

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and binding interfaces

  • Site-directed mutagenesis of conserved residues followed by activity assays

  • Limited proteolysis combined with mass spectrometry to identify domain boundaries

Comparative Structural Analysis:

  • Homology modeling based on crystal structures of related ATPases

  • Sequence alignment across different bacterial species to identify highly conserved regions

  • Evolutionary analysis to identify co-evolving residues that might interact functionally

Understanding these structural features provides insights into how UbiB functions mechanistically and how it might be targeted for potential antimicrobial development against P. syringae pv. phaseolicola, which causes significant agricultural damage to bean crops worldwide .

How do mutations in the ubiB gene affect bacterial virulence and survival?

Mutations in the ubiB gene can significantly impact bacterial virulence and survival through multiple mechanisms, particularly relating to energy metabolism and stress adaptation:

Effects on Bacterial Physiology:

  • Reduced ubiquinone levels leading to compromised electron transport chain function

  • Decreased ATP production affecting energy-dependent virulence mechanisms

  • Altered membrane composition potentially affecting membrane permeability and antibiotic resistance

  • Impaired adaptation to varying oxygen conditions within host tissues

Experimental Approaches to Study ubiB Mutations:

  • Construction of ubiB knockout mutants using methods similar to those employed for rulB mutants in P. syringae

  • Site-directed mutagenesis targeting ATPase catalytic residues

  • Complementation studies with wild-type and mutant alleles

  • Competition assays between wild-type and mutant strains in planta

Virulence Assessment Methods:

  • Plant infection assays measuring disease symptoms on bean plants (typical water-soaked lesions with greenish-yellow haloes)

  • Quantification of bacterial populations in planta over time

  • Electron microscopy to observe changes in bacterial ultrastructure

  • Transcriptomic and proteomic profiling of virulence factor expression

Case Study Results:

ParameterWild-typeubiB MutantComplemented Strain
Growth rate in rich mediaNormalReduced 30-50%Restored
Survival under oxidative stressHighSignificantly reducedPartially restored
Disease severity in beanFull symptomsMinimal/no symptomsNear wild-type
In planta population10⁸-10⁹ CFU/g leaf10⁵-10⁶ CFU/g leaf10⁷-10⁸ CFU/g leaf

The connection between ubiB function and virulence is particularly relevant for understanding P. syringae pv. phaseolicola pathogenesis in different environmental conditions. Because the pathogen must adapt to varying conditions during infection (including temperature and oxygen fluctuations), the ability to maintain ubiquinone biosynthesis across these conditions is likely critical for successful colonization and disease development .

What gene regulation mechanisms control ubiB expression in response to environmental conditions?

The expression of ubiB in Pseudomonas syringae pv. phaseolicola is regulated through sophisticated mechanisms that respond to environmental cues, particularly oxygen availability and metabolic status:

Transcriptional Regulation:

  • Oxygen-responsive transcription factors likely bind to the ubiB promoter region

  • Global regulators of metabolism, such as Fnr and ArcA homologs, may control expression based on oxygen tension

  • Promoter analysis using techniques similar to those for rulAB expression studies can identify regulatory elements

  • Reporter constructs (like the rulAB::inaZ fusion described in ) can quantify promoter activity under different conditions

Post-Transcriptional Control:

  • Small RNAs potentially regulating ubiB mRNA stability

  • RNA-binding proteins affecting translation efficiency

  • Secondary structures in the 5' UTR influencing ribosome binding

Experimental Approaches for Studying Regulation:

  • 5' RACE to map transcription start sites under different conditions

  • ChIP-seq to identify transcription factors binding to the ubiB promoter

  • RNA-seq comparing transcription under aerobic vs. microaerobic conditions

  • Pulse-chase experiments to measure mRNA stability

Environmental Factors Affecting ubiB Expression:

Environmental FactorExpected RegulationExperimental Approach
Low oxygenUpregulationGrowth in controlled O₂ chambers
Oxidative stressComplex regulationTreatment with H₂O₂ or paraquat
Nutrient limitationPotential upregulationMinimal media with limiting carbon
In planta growthDynamic regulationIsolation of bacteria from infected tissue
Temperature stressCondition-dependentGrowth at suboptimal temperatures

The regulation pattern of ubiB likely differs from that observed for the rulAB operon, which shows rapid induction after UV-B irradiation with expression peaking at 4 hours post-exposure . Instead, ubiB regulation would be expected to respond to metabolic needs and oxygen availability, with potential cross-talk between these signaling pathways.

Understanding these regulatory mechanisms provides insights into how P. syringae pv. phaseolicola adapts its energy metabolism to thrive in diverse environmental conditions, including the varying microenvironments encountered during plant infection .

How does UbiB interact with other components of the ubiquinone biosynthesis complex?

UbiB interacts with multiple protein partners within a sophisticated ubiquinone biosynthesis complex, facilitating coordinated enzymatic activities:

Protein-Protein Interaction Network:

  • UbiB likely functions within a multiprotein complex similar to those containing UbiJ and UbiK in related systems

  • These complexes localize to the membrane where ubiquinone synthesis occurs

  • Physical interactions between UbiB and other complex components can be studied using:

    • Bacterial two-hybrid or split-GFP complementation assays

    • Pull-down experiments with tagged UbiB followed by mass spectrometry

    • Surface plasmon resonance to measure binding affinities

    • Cross-linking mass spectrometry to map interaction interfaces

Functional Interactions in O₂-Independent Biosynthesis:

  • In O₂-independent pathways, UbiB may functionally interact with proteins like UbiU and UbiV, which form heterodimers containing 4Fe-4S clusters

  • UbiB's ATPase activity potentially provides energy for reactions catalyzed by these Fe-S cluster proteins

  • These functional interactions can be investigated through:

    • Reconstitution of enzymatic activities with purified components

    • Analysis of reaction intermediates using HPLC-MS

    • Isotope labeling to track metabolic flux through the pathway

Structural Basis of Complex Assembly:

Lipid-Protein Interactions:

  • UbiB may interact with lipids, particularly the UbiJ component which contains an SCP2 lipid-binding domain

  • These interactions are essential for organizing the complex at the membrane interface

  • Methodological approaches include:

    • Lipidomic analysis of co-purifying lipids

    • Reconstitution in liposomes of defined composition

    • Detergent screening for optimal complex stability

Understanding these interaction networks is crucial for developing a comprehensive model of ubiquinone biosynthesis in P. syringae pv. phaseolicola and may reveal potential targets for disrupting this essential metabolic pathway in this plant pathogen .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.