Recombinant Pseudomonas syringae pv. phaseolicola Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Prolipoprotein Diacylglyceryl Transferase (lgt)

Prolipoprotein diacylglyceryl transferase, encoded by the gene lgt, is an enzyme crucial for the modification of prolipoproteins in bacteria. In Pseudomonas syringae pv. phaseolicola, this enzyme plays a vital role in the maturation of lipoproteins, which are essential components of bacterial membranes and are involved in various cellular processes, including cell signaling and nutrient uptake.

The recombinant form of Pseudomonas syringae pv. phaseolicola prolipoprotein diacylglyceryl transferase refers to the enzyme produced through genetic engineering techniques, allowing for its expression in a controlled environment. This recombinant enzyme facilitates the study of its biochemical properties and potential applications in biotechnology.

Function of Prolipoprotein Diacylglyceryl Transferase

Prolipoprotein diacylglyceryl transferase catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, converting it into a mature lipoprotein . This modification is essential for the proper targeting and anchoring of lipoproteins to the bacterial membrane.

Table 1: Key Features of Prolipoprotein Diacylglyceryl Transferase

FeatureDescription
Enzyme FunctionTransfers diacylglyceryl group from phosphatidylglycerol to prolipoproteins.
SubstratePhosphatidylglycerol and prolipoproteins.
ProductMature lipoproteins.
Role in BacteriaEssential for lipoprotein maturation and membrane anchoring.

Research Findings and Applications

While specific research on the recombinant Pseudomonas syringae pv. phaseolicola prolipoprotein diacylglyceryl transferase is limited, studies on similar enzymes in other bacteria highlight their importance in bacterial physiology and potential applications in biotechnology. For instance, understanding how lipoproteins are modified can provide insights into bacterial pathogenesis and the development of novel antimicrobial strategies.

Table 2: Potential Applications of Prolipoprotein Diacylglyceryl Transferase

ApplicationDescription
Antimicrobial DevelopmentTargeting lipoprotein modification pathways could lead to new antibiotics.
BiotechnologyRecombinant enzymes can be used in protein engineering and biocatalysis.
Basic ResearchStudying lipoprotein maturation helps understand bacterial membrane biology.

References

- Pseudomonas syringae pv. phaseolicola studies on phaseolotoxin synthesis.
- PhtL protein's role in phaseolotoxin synthesis.
- AlgT gene in Pseudomonas syringae pv. glycinea.
- Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; PSPPH_4873; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVAVAIGPLQIHWYGLMYLVGIGGAWLLASRRLNKFDPTWTKEKLSDLIFWL AMGVIVGGRLGYVLFYDLSAYIANPLLIFEVWKGGMAFHGGFVGVMIAAWWFGKRNGKSF FQLMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMVFPPFSDPAQLARHPSQLYQF ALEGVALFIILNLYARKPRPTMAVSGMFALFYGIFRFVVEFVRVPDAQLGYLAWGWVTMG QILSLPMIIAGLFLIWLAYKRDPAASKAAA
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Pseudomonas syringae pv. phaseolicola and what is its significance in plant pathology?

    Pseudomonas syringae pv. phaseolicola is a plant pathogenic bacterium that causes halo blight disease of beans (Phaseolus vulgaris L.). The disease manifests as water-soaked lesions surrounded by a chlorotic halo, resulting from the action of the non-host-specific toxin called phaseolotoxin. This phytotoxin inhibits ornithine carbamoyltransferase, which is involved in arginine biosynthesis . P. syringae represents a highly diverse bacterial species complex capable of causing serious diseases on numerous agronomically important crops, making it a significant research subject in agricultural microbiology . Understanding its molecular mechanisms is crucial for developing effective disease management strategies.

  • What is prolipoprotein diacylglyceryl transferase (lgt) and what is its function in bacterial systems?

    Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification process of bacterial lipoproteins . It transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in prolipoprotein signal peptides. This post-translational modification is essential for bacterial lipoprotein biogenesis, which in turn is critical for bacterial survival. Deletion of the lgt gene is lethal to most Gram-negative bacteria, highlighting its essential nature . Bacterial lipoproteins fulfill diverse and vital biological functions, including maintenance of cell envelope architecture, outer membrane protein stabilization, nutrient uptake, transport, adhesion, invasion, and virulence.

  • How is horizontal gene transfer (HGT) related to the acquisition of lgt and pathogenicity genes in Pseudomonas syringae?

    Horizontal gene transfer (HGT) likely played a crucial role in the acquisition of pathogenicity genes in Pseudomonas syringae, including potentially the lgt gene. Research on P. syringae pv. phaseolicola has revealed that the phaseolotoxin gene cluster (Pht cluster) is flanked by insertion sequences and transposases, which are genetic elements associated with DNA mobility . This genomic organization suggests that the Pht cluster was acquired through horizontal gene transfer from another microorganism. Evidence for this includes the fact that the argK gene within the cluster has a G+C content of 49.4%, which is below that of the housekeeping gene argF (57.3%) and the hrp genes (56-58%) . Similarly, other virulence-associated loci show a pattern of genetic exchange between different phylogroups of P. syringae, indicating their mobile nature .

  • What experimental methods are used to characterize gene expression and function in the lgt system?

    Several experimental methods are employed to characterize gene expression and function in the lgt system:

    • Transcriptional analysis: Researchers use DNA fragment fusions to reporter genes (like uidA encoding β-glucuronidase), Northern probing, and reverse transcription-PCR to determine transcriptional patterns .

    • Promoter identification: Transcription initiation sites are mapped using techniques like primer extension, and promoter regions are identified through sequence analysis and functional testing .

    • Mutagenesis: Site-directed and random mutagenesis are used to identify critical residues, as demonstrated by studies showing Arg143 and Arg239 as essential for diacylglyceryl transfer activity .

    • Enzymatic assays: GUS (β-glucuronidase) assays are performed to measure promoter activity under different conditions, providing insights into gene regulation .

    • Complementation studies: Knockout mutants are complemented with different gene variants to assess functionality, helping to correlate structure with function .

  • What is the phylogenetic distribution of Pseudomonas syringae and how does it relate to lgt evolution?

    Pseudomonas syringae is divided into distinct phylogroups with significant genetic diversity. Phylogenetic and recombination analyses reveal that the species complex is subdivided into primary and secondary phylogroups . The primary phylogroups are primarily comprised of agricultural isolates, including all of the well-studied P. syringae strains, while the secondary phylogroups include numerous environmental isolates . These phylogroups exhibit levels of genetic diversity typically found among distinct species. The distribution of lgt and other virulence-associated genes across these phylogroups likely reflects both vertical inheritance and horizontal gene transfer events. Analysis shows higher rates of recombination within primary phylogroups than between primary and secondary phylogroups , suggesting that gene flow is somewhat restricted between major lineages but remains substantial within them.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.