Recombinant Pseudomonas syringae pv. phaseolicola Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, commonly known as ArnC, is an enzyme that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate . This enzymatic action is crucial because the modified arabinose is subsequently attached to lipid A, a process essential for resistance to polymyxin and cationic antimicrobial peptides . ArnC is found in Pseudomonas syringae pv. phaseolicola, a bacterium known for producing phaseolotoxin .

Role in Phaseolotoxin Production and Resistance

Pseudomonas syringae pv. phaseolicola synthesizes phaseolotoxin, a non-host-specific toxin that inhibits ornithine carbamoyltransferase (OCTase) activity in plants, mammals, and bacteria . This inhibition leads to a phenotypic requirement for arginine . To protect itself from its own toxin, P. syringae pv. phaseolicola produces a phaseolotoxin-resistant ornithine carbamoyltransferase (ROCT), which is encoded by the argK gene .

Genetic and Evolutionary Context

The argK gene, responsible for ROCT, is expressed coordinately with phaseolotoxin synthesis at 18°C . The argK and amtA genes are located on a 270-kbp PmeI fragment of the P. syringae pv. phaseolicola chromosome and possess a low G+C content compared to the bacterial genome . This characteristic, along with other evidence, indicates that the genes involved in phaseolotoxin biosynthesis, including argK, might have been acquired through horizontal transfer during evolution .

ArnC Function and Substrates

ArnC catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate . The enzyme utilizes UDP-4-formamido-L-arabinose and undecaprenyl phosphate as substrates . The resulting product, undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose, is a key intermediate in the synthesis of modified lipid A, which is crucial for bacterial resistance to antimicrobial peptides .

Functional Partners and Interactions

ArnC interacts with several functional partners that are crucial in the modification of lipid A and resistance to antimicrobial peptides . Key partners include:

  • ArnA: A bifunctional enzyme that catalyzes the oxidative decarboxylation of UDP-glucuronic acid (UDP-GlcUA) to UDP-4-keto-arabinose (UDP-Ara4O) and adds a formyl group to UDP-4-amino-4-deoxy-L-arabinose (UDP-L-Ara4N) to form UDP-L-4-formamido-arabinose (UDP-L-Ara4FN) .

  • ArnB: Catalyzes the conversion of UDP-4-keto-arabinose (UDP-Ara4O) to UDP-4-amino-4-deoxy-L-arabinose (UDP-L-Ara4N) .

  • ArnT: Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A .

  • ArnD: Catalyzes the deformylation of 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol to 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol .

  • ArnE and ArnF: Involved in the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol from the cytoplasmic to the periplasmic side of the inner membrane .

These interactions are vital for the bacterium's ability to modify its lipid A and resist antimicrobial peptides .

Role in Virulence

Mutation of avrE orthologs, including those in P. syringae, significantly reduces the virulence of several bacteria . AvrE, a Pseudomonas syringae pv tomato DC3000 effector protein, is localized in the plasma membrane and down-regulates the expression of the NHL13 gene in Arabidopsis, which is required for plant immunity .

Table Summarizing Key Features of ArnC

FeatureDescription
Enzyme NameUndecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC)
OrganismPseudomonas syringae pv. phaseolicola
FunctionCatalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate
SubstratesUDP-4-formamido-L-arabinose, Undecaprenyl phosphate
ProductUndecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose
RoleEssential for resistance to polymyxin and cationic antimicrobial peptides
Genetic ContextLocated on a 270-kbp fragment with low G+C content, possibly acquired via horizontal gene transfer
Functional PartnersArnA, ArnB, ArnT, ArnD, ArnE, ArnF
Involvement in VirulenceContributes to virulence by modifying lipid A, which affects the bacterium's ability to interact with and colonize hosts; AvrE, functionally redundant to HopM1, impacts plant immunity by down-regulating the expression of the NHL13 gene in Arabidopsis thaliana .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
arnC; PSPPH_2803; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
arnC
Target Protein Sequence
MRPYPIKFVSIVIPVYNERQSLPELLRRTEAACKHLNHRFEIVLVDDGSRDDSAEILQQA AERSASPFVAVILNRNYGQHAAIMAGFEQCKGDVVITLDADLQNPPEEIPRLVALAEQGY DVVGTVRSNRQDSAWRRWPSKIINVAVQRSTGVAMSDYGCMLRAYRRTIVDAMLACRERS TFIPILANSFARHTTEVLVDHAEREHGDSKYSPMRLVNLMFDLITCMTTTPLRLLSIIGF SMALLGVLFAALLIILRLIFGAPWAGDGTFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD VRARPRFFIEKVVRSSSEVVSESVDSSVTPYMNKVAP
Uniprot No.

Target Background

Function

This recombinant Pseudomonas syringae pv. phaseolicola undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A and is essential for resistance to polymyxin and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the primary function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in bacterial systems?

  • What structural domains characterize ArnC and how do they contribute to its catalytic function?

ArnC exhibits a complex multi-domain architecture essential for its membrane-associated glycosyltransferase activity:

  • Transmembrane Domain (TMD): Anchors the protein within the bacterial inner membrane

  • Juxtamembrane (JM) helices: Function as a gateway for the lipid substrate, facilitating the entry of undecaprenyl phosphate to the active site

  • GT-A domain: Contains the catalytic center for glycosyltransferase activity, including the metal-binding site

  • DXD motif: A conserved sequence within the GT-A domain that participates in metal coordination and catalysis

Cryo-electron microscopy structures have revealed that these domains work in concert, with the protein undergoing significant conformational changes between apo and substrate-bound states. The JM helices create a pathway for UndP to thread through to reach the GT-A domain where the catalytic reaction occurs .

  • What experimental approaches are recommended for expression and purification of recombinant ArnC?

Successful expression and purification of recombinant ArnC requires specialized approaches for membrane proteins:

StageRecommended MethodologyCritical Considerations
Expression SystemE. coli with inducible promoters (T7, araBAD)Temperature reduction during induction (16-18°C) improves proper folding
Membrane ExtractionDetergent solubilization (DDM, LMNG)Gentle extraction to maintain protein integrity
PurificationIMAC followed by size exclusion chromatographyBuffer optimization with stabilizing agents (glycerol, specific lipids)
ReconstitutionNanodisc incorporation with MSP proteinsSelection of appropriate lipid composition mimicking native environment

For structural studies, researchers have successfully employed lipid nanodiscs to maintain ArnC in a native-like membrane environment compatible with techniques such as cryo-electron microscopy. This approach preserves protein structure and function while providing a suitable sample for high-resolution structural analysis .

  • How does ArnC contribute to antibiotic resistance mechanisms in Gram-negative bacteria?

ArnC plays a pivotal role in the multistep pathway that confers resistance to polymyxin antibiotics and cationic antimicrobial peptides in Gram-negative bacteria. The enzymatic modification catalyzed by ArnC is part of the Arn pathway that ultimately results in the addition of aminoarabinose to Lipid A in the bacterial outer membrane. This modification process occurs through the following sequence:

  • ArnC attaches formylated aminoarabinose to undecaprenyl phosphate at the inner membrane

  • The modified lipid carrier is flipped across the membrane

  • The aminoarabinose moiety is transferred to Lipid A molecules

  • The resulting modified Lipid A reduces the negative charge of the outer membrane

  • The altered membrane charge decreases binding affinity for cationic antimicrobial peptides

This mechanism represents a significant clinical concern as it enables bacterial resistance to polymyxins, which are often used as last-resort antibiotics for multidrug-resistant Gram-negative infections. Targeting ArnC could potentially restore sensitivity to these important antimicrobial agents .

Advanced Research Questions

  • What is the molecular mechanism of metal-dependent catalysis in ArnC?

The catalytic mechanism of ArnC involves metal-dependent glycosyltransferase activity that has been elucidated through structural studies and molecular dynamics simulations. The mechanism is characterized by:

  • Metal coordination: A divalent metal ion (Mn²⁺) coordinates with the DXD motif and the phosphate groups of the UDP-sugar donor substrate

  • Substrate positioning: Two distinct coordination positions for undecaprenyl phosphate (UndP) have been identified within the GT-A domain, designated as P1 ("standby") and P2 ("catalysis")

  • Nucleophile activation: The first aspartate of the DXD motif, which does not participate in metal coordination, functions as a catalytic base to abstract a proton from UndP's phosphate group

  • Nucleophilic attack: The activated (partially deprotonated) phosphate oxygen of UndP performs a nucleophilic attack on the C1 carbon of the sugar moiety

  • Glycosidic bond formation: The nucleophilic attack results in the formation of a glycosidic bond and release of UDP

This mechanism appears to be conserved across metal-dependent polyprenyl phosphate glycosyltransferases. Microscale thermophoresis experiments have confirmed that Mn²⁺ significantly enhances UDP binding affinity, underscoring the essential role of metal coordination in substrate recognition and catalysis .

  • How do conformational changes regulate ArnC activity during the catalytic cycle?

Structural and computational studies have revealed that ArnC undergoes significant conformational changes during its catalytic cycle that are essential for enzyme function:

Conformational StateStructural CharacteristicsFunctional Significance
Apo (unbound)Open conformation with GT-A domain positioned away from JM helicesAllows initial substrate access and binding
UDP-boundClamshell-like closure bringing GT-A domain closer to JM helicesCreates optimal geometry for catalysis
UndP-binding transitionReorientation of JM helicesFacilitates threading of UndP substrate to active site
Catalytic complexPrecise alignment of both substrates with metal ionEnables nucleophilic attack and glycosyl transfer

The binding of UDP and Mn²⁺ triggers the conformational rearrangement, acting as a molecular switch that prepares the enzyme for catalysis. Molecular dynamics simulations suggest that these conformational changes are not merely static states but part of a dynamic continuum that guides the substrates through the reaction coordinate. The conformational plasticity of ArnC appears critical for accommodating the bulky lipid substrate while maintaining precise positioning of the catalytic residues .

  • What structural insights have cryo-electron microscopy studies provided about ArnC function?

Cryo-electron microscopy (cryo-EM) has been instrumental in elucidating the structural basis of ArnC function. Studies have successfully determined structures of ArnC from Salmonella enterica in both apo and nucleotide-bound conformations, revealing several key insights:

  • Transmembrane topology: The structures confirmed that ArnC is an integral membrane protein with multiple transmembrane helices anchoring the protein in the bacterial inner membrane.

  • Conformational transitions: Comparison between apo and UDP-bound structures revealed a significant conformational change upon nucleotide binding, characterized by a clamshell-like motion that brings the GT-A domain closer to the juxtamembrane helices.

  • Substrate entry pathway: The structures illuminated how the juxtamembrane helices likely create a pathway for the lipid substrate undecaprenyl phosphate to reach the catalytic site.

  • Metal coordination: The UDP-bound structure showed how the metal ion (Mn²⁺) is coordinated within the active site, involving the DXD motif and the phosphate groups of UDP.

  • Lipid interactions: Non-protein densities observed in the cryo-EM maps suggested specific interactions with membrane lipids, particularly around the transmembrane domain and within specific cavities of the protein.

The structural data, combined with molecular dynamics simulations, provided insights into substrate coordination before and during catalysis, leading to a proposed catalytic mechanism that may operate across similar metal-dependent polyprenyl phosphate glycosyltransferases .

  • What computational approaches can effectively predict substrate interactions and catalytic mechanisms of ArnC?

Multiple computational approaches have proven valuable for investigating ArnC function at the molecular level:

  • Coarse-grained simulations: These have been used to study how ArnC interacts with membrane lipids and how undecaprenyl phosphate binds to the protein. The LipIDens pipeline has been employed to interpret lipid-like densities in cryo-EM structures, revealing cardiolipin binding to a groove on the periplasmic transmembrane domain face with a residence time of approximately 0.4-0.5 μs .

  • Atomistic molecular dynamics simulations: More detailed simulations with the acceptor UndP and donor UDP-L-Ara4FN substrates have identified two different coordination positions for UndP within the GT-A domain, providing insights into the catalytic mechanism .

  • Quantum mechanical/molecular mechanical (QM/MM) calculations: These can model the electron transfer processes during catalysis, particularly the nucleophilic attack by the activated phosphate oxygen on the C1 carbon of the sugar.

  • Homology modeling: For related enzymes where experimental structures are unavailable, homology modeling based on ArnC can predict structural features and substrate interactions.

  • Virtual screening and docking: These approaches can identify potential inhibitors that might bind to the active site or allosteric sites of ArnC.

These computational methods complement experimental studies and can guide the design of targeted experiments to validate hypotheses about substrate recognition, binding, and catalysis. The integration of computational and experimental approaches has been particularly powerful for understanding the dynamic aspects of ArnC function that are difficult to capture with structural techniques alone .

  • How can site-directed mutagenesis be designed to validate the proposed catalytic mechanism of ArnC?

A comprehensive site-directed mutagenesis strategy to validate the proposed catalytic mechanism of ArnC should target residues involved in different aspects of enzyme function:

Target RegionSpecific ResiduesMutation StrategyExpected Effect if Mechanism is Correct
DXD MotifFirst AspartateD→N (conservative) D→A (disruptive)Loss of catalytic activity but partial retention of substrate binding
DXD MotifSecond AspartateD→N D→ADisruption of metal coordination and substantial loss of activity
Metal Coordination SiteAdditional coordinating residuesTo AlanineReduced metal binding and catalytic efficiency
UndP Binding Site (P1)Residues lining "standby" positionConservative substitutionsAltered substrate binding kinetics
UndP Binding Site (P2)Residues lining "catalysis" positionConservative substitutionsSevere catalytic defects
Juxtamembrane HelicesResidues forming UndP entry pathHydrophobicity alterationsImpaired UndP access to active site
Conformational SwitchResidues at domain interfacesIntroduction of disulfidesRestricted conformational changes affecting catalysis

Each mutant should be characterized through multiple approaches:

  • In vitro enzyme activity assays measuring glycosyltransferase function

  • Binding studies using microscale thermophoresis to assess substrate affinity

  • Structural analysis of key mutants to observe conformational effects

  • Bacterial resistance assays to correlate biochemical defects with biological function

This systematic approach would provide experimental validation of the proposed two-position mechanism and identify which residues are critical for substrate binding versus those essential for catalysis .

  • What are the major differences between ArnC from Pseudomonas syringae pv. phaseolicola and homologous enzymes in other Gram-negative bacteria?

ArnC from Pseudomonas syringae pv. phaseolicola exhibits both conserved features and notable differences compared to homologous enzymes in other Gram-negative bacteria:

  • Genetic context: In P. syringae pv. phaseolicola, genomic analysis reveals interesting differences between toxin-producing (Tox+) and non-toxin-producing (Tox-) strains. These differences may extend to the genetic context of ArnC, with potential implications for its regulation and function within these distinct genetic lineages (Pph1 and Pph2) .

  • Substrate specificity: While the core glycosyltransferase activity is conserved, subtle differences in the binding pockets may confer species-specific preferences for slightly different forms of the donor substrate.

  • Regulation: The expression and regulation of ArnC vary considerably across bacterial species. In some pathogens, it is constitutively expressed, while in others it is strictly regulated by two-component systems responding to environmental signals.

  • Association with virulence factors: In P. syringae pv. phaseolicola, genomic studies have identified a pathogenicity island that differs between Tox+ and Tox- strains. The relationship between this pathogenicity island and components of the aminoarabinose modification pathway, including ArnC, may represent a unique aspect of this organism's biology .

  • Insertion sequence elements: Genomic analyses have shown distinct patterns of IS801 insertions between different P. syringae pv. phaseolicola lineages. These mobile genetic elements can influence gene expression and function, potentially affecting ArnC and related genes .

Understanding these differences is crucial for developing species-specific strategies to target ArnC and combat polymyxin resistance while accounting for the unique biological context of each pathogen .

  • How can high-throughput screening approaches be optimized to identify potential inhibitors of ArnC?

Designing effective high-throughput screening (HTS) campaigns for ArnC inhibitors requires specialized approaches to address the challenges of targeting a membrane-bound glycosyltransferase:

  • Assay development:

    • Primary assay: A fluorescence-based glycosyltransferase assay using modified UDP-sugars with attached fluorophores can detect transfer activity

    • Secondary assay: Microscale thermophoresis to measure disruption of substrate binding

    • Tertiary assay: Whole-cell screening for restoration of polymyxin sensitivity in resistant strains

  • Membrane protein considerations:

    • Stable recombinant expression system optimized for ArnC

    • Reconstitution in nanodiscs or proteoliposomes to maintain native-like environment

    • Selection of detergents that preserve activity while allowing compound access

  • Compound library design:

    • Focused libraries based on known glycosyltransferase inhibitors

    • Fragment-based approaches for this challenging target

    • Natural product libraries enriched for compounds with antibacterial activity

    • Inclusion of substrate analogs targeting either the UDP-sugar or lipid binding sites

  • Screening conditions optimization:

    • Metal ion concentration (Mn²⁺) optimization for consistent activity

    • Buffer composition to maintain protein stability

    • Temperature and pH standardization to maximize signal-to-noise ratio

  • Data analysis and hit selection:

    • Structure-activity relationship development from primary hits

    • Classification of inhibitors by mechanism (competitive vs. non-competitive)

    • Prioritization based on physicochemical properties suitable for penetrating bacterial membranes

The structural insights from cryo-EM studies of ArnC provide a foundation for rational design approaches that can complement HTS efforts, potentially leading to the development of novel adjuvants that restore polymyxin sensitivity in resistant bacteria .

  • What is the physiological significance of the conformational dynamics of ArnC in the bacterial membrane environment?

The conformational dynamics of ArnC within the bacterial membrane environment serve several critical physiological functions:

  • Substrate accessibility regulation: The conformational changes between open (apo) and closed (substrate-bound) states likely regulate access to the active site, preventing non-productive interactions and optimizing catalytic efficiency in the crowded membrane environment.

  • Lipid substrate recruitment: Molecular dynamics simulations have revealed that undecaprenyl phosphate (UndP) can spontaneously and stably bind within the GT-A domain with residence times of approximately 8 μs. This suggests that the conformational dynamics of ArnC actively facilitate the recruitment of this lipid substrate from the membrane .

  • Catalytic cycle coordination: The clamshell-like motion observed upon UDP binding brings the GT-A domain closer to the juxtamembrane helices, creating an optimal geometry for catalysis. This coordinated movement ensures proper alignment of substrates and catalytic residues.

  • Integration with membrane physiology: ArnC's conformational dynamics appear sensitive to the membrane environment, with specific interactions observed with cardiolipin and other membrane lipids. Coarse-grained simulations have identified a groove on the periplasmic transmembrane domain face where cardiolipin preferentially binds .

  • Response to environmental signals: The conformational state of ArnC may be influenced by membrane properties that change in response to environmental stresses, potentially linking polymyxin resistance mechanisms directly to sensing of threatening conditions.

Understanding these dynamics is essential for developing strategies to disrupt ArnC function, as inhibitors could potentially target specific conformational states or transitions rather than just the active site itself .

  • How can genetic manipulation techniques be applied to investigate the in vivo function of ArnC in antimicrobial resistance?

Several genetic manipulation approaches can effectively investigate ArnC's in vivo role in antimicrobial resistance:

  • Gene deletion and complementation studies:

    • CRISPR-Cas9 mediated precise deletion of arnC gene

    • Complementation with wild-type or mutant variants on plasmids

    • Assessment of polymyxin susceptibility through minimum inhibitory concentration (MIC) determination

    • Analysis of Lipid A modifications using mass spectrometry

  • Conditional expression systems:

    • Replacing native promoter with inducible systems (tetracycline-responsive, arabinose-inducible)

    • Titrating ArnC expression levels to determine threshold requirements

    • Temporal control to assess how quickly resistance develops or is lost

  • Fluorescent protein fusions:

    • C-terminal or internal fluorescent protein tags to monitor localization

    • Förster resonance energy transfer (FRET) pairs to detect interactions with other Arn pathway proteins

    • Correlation of expression patterns with resistance phenotypes

  • Point mutations based on structural insights:

    • Introduction of specific mutations at the chromosomal locus

    • Combined mutations across the Arn pathway to assess synergistic effects

    • Conservative mutations to distinguish between catalytic and structural roles

  • Interspecies domain swapping:

    • Replacing ArnC domains with homologous regions from other species

    • Identification of species-specific features affecting resistance profiles

    • Creation of chimeric proteins to map functional determinants

  • Screening in infection models:

    • Evaluation of wild-type and arnC mutants in animal infection models

    • Assessment of survival under antibiotic treatment

    • In vivo competition assays between wild-type and mutant strains

These genetic approaches can be particularly valuable for understanding the specific contributions of ArnC to antimicrobial resistance in Pseudomonas syringae pv. phaseolicola, especially given the reported genomic differences between toxin-producing (Tox+) and non-toxin-producing (Tox-) strains that might influence resistance mechanisms .

  • What research protocols can effectively analyze the interaction between ArnC and other components of the aminoarabinose modification pathway?

Investigating interactions between ArnC and other Arn pathway components requires multi-faceted experimental approaches:

  • Co-immunoprecipitation and pull-down assays:

    • Design of epitope-tagged versions of ArnC and other Arn proteins

    • Optimization of membrane protein extraction conditions

    • Mass spectrometry analysis of co-purified proteins

    • Quantitative comparison of interaction profiles under different conditions

  • Bacterial two-hybrid systems:

    • Adaptation of split-protein complementation assays for membrane proteins

    • Systematic testing of binary interactions between all Arn pathway components

    • Generation of interaction maps under different growth conditions

  • Förster resonance energy transfer (FRET):

    • Creation of fluorescent protein fusions to ArnC and potential partners

    • Live-cell imaging to detect proximal interactions

    • FRET efficiency measurements to estimate interaction distances

  • Chemical crosslinking coupled with mass spectrometry:

    • Application of membrane-permeable crosslinkers

    • Identification of crosslinked peptides to map interaction interfaces

    • Use of varying crosslinker lengths to estimate proximity constraints

  • Cryo-electron tomography:

    • Visualization of Arn protein complexes in their native membrane environment

    • Subtomogram averaging to enhance resolution of recurring complexes

    • Immunogold labeling to identify specific components

  • Proteoliposome reconstitution:

    • Co-reconstitution of purified ArnC with other Arn pathway components

    • Functional assays to assess how complexes affect enzymatic activity

    • Structural studies of reconstituted complexes

  • Genetic suppressor screens:

    • Identification of mutations in other Arn proteins that compensate for specific ArnC defects

    • Mapping of functional interactions through genetic means

    • Discovery of unexpected pathway connections

These methodologies can reveal whether ArnC functions independently or as part of a larger multi-enzyme complex, information that could be crucial for understanding the coordinated process of aminoarabinose addition to Lipid A and for developing strategies to disrupt this process .

  • How does the genetic diversity of Pseudomonas syringae pv. phaseolicola influence ArnC function and polymyxin resistance profiles?

The genetic diversity of Pseudomonas syringae pv. phaseolicola has significant implications for ArnC function and antimicrobial resistance:

  • Distinct genetic lineages: Research has identified two distinct genetic lineages of P. syringae pv. phaseolicola, designated Pph1 (Tox+) and Pph2 (Tox-), which show significant genomic differences including the pathogenicity gene complement. These divergent backgrounds likely influence the expression and regulation of resistance mechanisms, including those involving ArnC .

  • Genomic insertion sequences: Tox+ isolates show distinct patterns of IS801 genomic insertions, including a chromosomal IS801 insertion absent from Tox- isolates. These mobile genetic elements can affect gene expression patterns and potentially influence ArnC function through direct or indirect mechanisms .

  • Pathogenicity island variation: A pathogenicity island essential for P. syringae pv. phaseolicola pathogenicity on beans appears to be conserved among Tox+ but not among Tox- isolates. This genomic region may interact with resistance mechanisms, creating lineage-specific patterns of antimicrobial susceptibility .

  • Plasmid content differences: Tox- isolates lack the characteristic large plasmid that carries the pathogenicity island found in Tox+ strains. Plasmids can harbor additional resistance determinants or regulatory elements that affect chromosomal gene expression, potentially influencing ArnC function .

  • Heteroduplex mobility assay results: Sequence differences have been observed in the intergenic transcribed spacer of the rDNA operons of Tox- isolates, suggesting broader genomic divergence that could extend to regions affecting antimicrobial resistance mechanisms .

Understanding how these genetic differences influence ArnC function and polymyxin resistance requires comparative genomic and functional studies across diverse isolates. Such research could reveal strain-specific vulnerabilities that might be exploited for targeted antimicrobial strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.