Recombinant Pseudomonas syringae pv. phaseolicola UPF0060 membrane protein PSPPH_1503 (PSPPH_1503)

Shipped with Ice Packs
In Stock

Description

General Information

PSPPH_1503 is a membrane protein originating from Pseudomonas syringae pv. phaseolicola. P. syringae pv. phaseolicola is a Gram-negative bacterium known to cause halo blight, a disease affecting beans (Phaseolus vulgaris L.) . Halo blight impacts both the foliage and pods of bean plants, posing a significant agricultural challenge in temperate regions .

Protein Structure and Function

The tertiary structure of a protein refers to its three-dimensional shape, which arises from interactions between secondary structural elements such as alpha helices and beta-pleated sheets . These interactions involve various types of bonds, including disulfide bonds, hydrogen bonds, ionic bonds, and hydrophobic interactions . Proteins exhibit a wide range of functions, including structural support, motility, cell division, enzymatic catalysis, transport, storage, adhesion, immune response, and communication .

Role in Pathogenesis

P. syringae employs diverse virulence factors, such as the type III secretion system (T3SS), phytotoxins, phytohormones, ice nucleation activity, plant cell wall-degrading enzymes, and exopolysaccharides . Exopolysaccharides have been linked to virulence in several phytopathogenic bacteria . P. syringae produces various biofilm matrix polysaccharides, including alginate, levan, and cellulose .

Expression and Regulation

Transcriptional profiling has revealed that numerous genes in P. syringae pv. phaseolicola are differentially expressed in response to bean leaf extract and apoplastic fluid . Some induced genes are known to participate in the early stages of bacterial-plant interaction and virulence, including those encoding type III secretion system proteins, cell-wall degradation enzymes, phaseolotoxin synthesis, and aerobic metabolism . Conversely, many repressed genes are involved in iron uptake and metabolism .

Post-translational Modification

Amino acid phosphorylation in proteins can cause a switch from an inactive functional state to an active one .

Tables

Tables are used to organize data that is too detailed or complicated to be described adequately in the text, allowing the reader to quickly see the results .

Use a TableUse a FigureUse Text
To show many and precise numerical values and other specific data in a small space To show trends, patterns, and relationships across and between datasets When you don't have extensive data to present
To compare and contrast data values with several shared characteristics or variables To summarize research results When putting your data into a table would mean creating a table with 2 or fewer columns
To show the presence or absence of specific characteristics To present a visual explanation of a sequence of events, procedures, or characteristics When the data that you are planning to present is irrelevant to the main study findings .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
PSPPH_1503; UPF0060 membrane protein PSPPH_1503
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Target Names
PSPPH_1503
Target Protein Sequence
MLNYLWFFLAALFEIFGCYAFWLWLRQGKSALWVIPALISLTLFALLLTRVEAAYAGRAY AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PSPPH_1503 and how is it classified within the Pseudomonas syringae pv. phaseolicola genome?

PSPPH_1503 is classified as a UPF0060 family membrane protein encoded within the genome of Pseudomonas syringae pv. phaseolicola (Psph) 1448A. This protein belongs to a family of uncharacterized proteins (UPF0060) with predicted membrane localization. Within the context of the comprehensive genome-wide transcriptional regulatory network of Psph 1448A, PSPPH_1503 has been identified as a potentially significant protein that may participate in environmental response mechanisms . The protein is part of the complex network architecture that includes multiple transcription factors (TFs) and regulatory elements that collectively control gene expression patterns in response to various stimuli. The current annotation is based on genomic databases such as the 'Pseudomonas Genome DB,' which houses comprehensive information about all 301 annotated TFs in the Psph 1448A genome .

How does PSPPH_1503 relate to the virulence mechanisms of Pseudomonas syringae pv. phaseolicola?

The relationship between PSPPH_1503 and virulence mechanisms appears to be integrated within the broader regulatory networks that control pathogenicity in Psph 1448A. While specific details about PSPPH_1503's direct role in virulence remain to be fully characterized, research on the Psph 1448A regulatory network (PSRnet) has revealed the involvement of hundreds of functional genes in virulence pathways . PSPPH_1503 likely operates within this network, potentially responding to changing environmental conditions similar to other components of the PSTCSome (Psph 1448A TCS regulome) network . The virulence mechanisms of Psph typically involve complex interactions between multiple regulatory elements, including transcription factors that can bind within coding sequences (CDS) and interact with cryptic promoters, regulating the expression of subgenus and antisense RNAs . Further characterization of PSPPH_1503 would require experimental approaches similar to those used for other virulence-related proteins, potentially including gene knockout studies followed by pathogenicity assays on bean plants.

What detection methods can be used to identify and quantify PSPPH_1503 expression in laboratory samples?

Detection and quantification of PSPPH_1503 expression can be accomplished through several molecular techniques:

  • RT-qPCR (Real-Time Quantitative PCR): This remains the gold standard for gene expression analysis. For PSPPH_1503, primers specific to the coding sequence would be designed, followed by RNA extraction, cDNA synthesis, and real-time PCR quantification. This approach has been successfully used for other genes in Psph 1448A, such as flagellar regulators fleQ and flhF .

  • RNA-Seq Analysis: For genome-wide expression profiling, RNA-Seq can provide comprehensive data on PSPPH_1503 expression under various conditions, allowing comparative analysis across different growth media (e.g., King's B medium versus minimal media) as has been done for other Psph genes .

  • Western Blotting: With appropriate antibodies raised against the recombinant PSPPH_1503 protein, Western blotting can detect and semi-quantify protein levels.

  • Reporter Gene Fusions: Similar to the luminescence reporter system used for T3SS-related proteins in Psph, a reporter gene (e.g., GFP, luciferase) can be fused to the PSPPH_1503 promoter to monitor expression patterns in real-time .

For all these methods, appropriate controls and standardization procedures must be implemented to ensure reliability of results, particularly when comparing expression levels across different experimental conditions.

How can ChIP-seq be optimized for studying PSPPH_1503 interactions with transcription factors?

Optimizing ChIP-seq for studying PSPPH_1503 interactions with transcription factors requires several strategic modifications to standard protocols:

Sample Preparation:

  • Culture Psph 1448A under conditions that potentially induce PSPPH_1503 expression (e.g., mimicking plant infection environments or stress conditions).

  • Apply crosslinking with formaldehyde (typically 1%) to preserve protein-DNA interactions in vivo.

  • Generate cell lysates through careful sonication to fragment DNA while preserving protein-DNA complexes.

Immunoprecipitation Strategy:
Either epitope-tag PSPPH_1503 (if studying its DNA-binding properties) or use antibodies against transcription factors of interest. Based on the Psph 1448A transcriptional network architecture, priority should be given to TFs from families showing high binding activity, such as LysR, TetR, AsnC, GntR, and AraC families .

Data Analysis Pipeline:
After sequencing, implement analytical approaches similar to those used in the comprehensive ChIP-seq analysis of 170 TFs in Psph 1448A . This should include:

  • Peak calling to identify TF binding sites

  • Motif discovery to characterize binding preferences

  • Integration with transcriptomic data to correlate binding with gene expression

Validation Requirements:
Confirm ChIP-seq findings with complementary methods such as EMSA (Electrophoretic Mobility Shift Assay) for in vitro validation, as was done for motility-related genes in Psph 1448A .

This approach has already yielded significant insights for other regulatory proteins in Psph 1448A, revealing over 26,000 DNA-binding peaks distributed across different regions of target genes .

What experimental approaches can determine if PSPPH_1503 participates in three-node regulatory submodules?

Determining PSPPH_1503's participation in three-node regulatory submodules requires a multi-faceted experimental approach that builds upon network analysis methodologies:

Network Inference Methodology:

  • Directed ChIP-seq Experiments: Perform ChIP-seq for PSPPH_1503 and potential interacting TFs to establish direct binding relationships.

  • Transcriptome Analysis: Conduct RNA-Seq in wild-type and PSPPH_1503 knockout strains to identify genes differentially regulated.

  • Network Construction: Use algorithms designed to detect recurring modules (similar to those used by Shen-Orr et al.) to identify potential three-node submodules involving PSPPH_1503 .

Validation Protocol:

  • Gene Deletions: Create single, double, and triple knockouts of the nodes in identified submodules.

  • Reporter Systems: Develop fluorescent/luminescent reporters for each node to track expression dynamics.

  • Perturbation Analysis: Apply environmental stressors or simulate host conditions to observe module behavior.

Classification Framework:
Based on identified interactions, classify PSPPH_1503's participation according to the submodule categories identified in the Psph regulatory network :

  • "Ringent loops" (M1-M6): Where two TF nodes establish a relationship through another node

  • Toggle switches: Where mutually regulating TFs interact

  • Complex regulatory circuits: Where all three nodes directly interact

Current network analysis of Psph 1448A has revealed 40,307 different pairs across 13 basic three-node submodules, with simple "ringent loops" (especially M1 with 24,479 instances) being particularly prevalent . This suggests that even complex regulatory behaviors often rely on simple but efficient modes of transcriptional regulation in this pathogen.

How should researchers design knockout experiments to evaluate PSPPH_1503 function in planta?

Designing effective knockout experiments to evaluate PSPPH_1503 function in planta requires careful consideration of multiple factors:

Mutant Construction Strategy:

  • Generate a clean deletion mutant (ΔPSPPH_1503) using allelic exchange methodology with non-polar effects on adjacent genes.

  • Create a complemented strain by reintroducing PSPPH_1503 under its native promoter on a stable plasmid.

  • Develop a PSPPH_1503-overexpression strain to assess gain-of-function phenotypes.

Experimental Design Parameters:

  • Plant Infection Assays:

    • Use the standard bean leaf infiltration method with bacterial suspensions of 1×10⁸ CFU/ml.

    • Measure bacterial populations at 0, 3, and 5 days post-inoculation by homogenizing leaf tissue and plating dilutions.

    • Compare growth kinetics of wild-type, ΔPSPPH_1503, and complemented strains.

  • Phenotypic Analysis:

    • Evaluate motility using standard swim plate assays in King's B medium (as performed for PSPPH2193) .

    • Assess biofilm formation capacity using crystal violet staining.

    • Monitor production of virulence factors using appropriate biochemical assays.

  • Molecular Response Evaluation:

    • Perform RNA-Seq or RT-qPCR to identify genes differentially expressed in the ΔPSPPH_1503 mutant.

    • Use ChIP-seq to compare transcription factor binding patterns between wild-type and mutant strains.

Data Analysis Framework:

  • Apply statistical methods similar to those used in virulence studies of other Psph mutants.

  • Integrate phenotypic data with transcriptomic profiles to establish functional networks.

This approach parallels successful functional characterization of other Psph genes, such as PSPPH2193, where deletion significantly reduced bacterial motility and pathogenicity in plant infection assays .

What statistical approaches are most appropriate for analyzing PSPPH_1503 expression data across different experimental conditions?

Appropriate Statistical Methods:

  • For Differential Expression Analysis:

    • Use linear models with empirical Bayes moderation (e.g., limma) for microarray data

    • Apply negative binomial distribution models (e.g., DESeq2, edgeR) for RNA-Seq data

    • Implement ANOVA with post-hoc tests (e.g., Tukey's HSD) when comparing multiple conditions

  • For Time-Series Expression Data:

    • Apply mixed-effects models to account for temporal correlations

    • Consider functional data analysis approaches for continuous profiling

    • Use specialized packages designed for time-course experiments (e.g., maSigPro)

  • For Correlation with Other Variables:

    • Use Pearson or Spearman correlation coefficients depending on data distribution

    • Apply multiple regression for multifactorial analysis

    • Consider partial least squares regression for high-dimensional data integration

Presentation of Statistical Results:

Data should be presented using the principles outlined in research data presentation guidelines :

  • Use tables for precise numerical values

  • Employ graphics for highlighting trends

  • Ensure statistical significance is clearly marked

Experimental ConditionPSPPH_1503 Expression (Relative to Reference Gene)p-valueStatistical Test
King's B Medium1.00 ± 0.15--
Minimal Medium2.34 ± 0.28<0.001Student's t-test
In planta (24h)4.56 ± 0.52<0.001Student's t-test
Oxidative Stress3.21 ± 0.41<0.001Student's t-test

Multiple Testing Correction:
When analyzing genome-wide expression data that includes PSPPH_1503, researchers should implement appropriate multiple testing corrections (e.g., Benjamini-Hochberg FDR) to control for false positives, similar to the approaches used in analyzing the comprehensive ChIP-seq data for the 170 TFs in Psph 1448A .

How can researchers integrate PSPPH_1503 data into the broader Pseudomonas syringae pv. phaseolicola transcriptional regulatory network?

Integrating PSPPH_1503 data into the broader Psph transcriptional regulatory network requires a systematic multi-omics approach:

Integration Framework:

  • Hierarchical Network Construction:

    • Position PSPPH_1503 within the established hierarchical network that currently integrates DNA-binding data of 270 TFs (170 from ChIP-seq studies and 100 from SELEX research) .

    • Map PSPPH_1503 interactions with known TFs to identify its position in regulatory cascades.

    • Determine whether PSPPH_1503 belongs to specific three-node submodules among the 40,307 different pairs identified across 13 basic three-node submodules in the Psph network .

  • Multi-omics Data Integration Protocol:

    • Combine transcriptomic data (RNA-Seq) with binding data (ChIP-seq) to establish cause-effect relationships.

    • Incorporate proteomics data to validate expression at protein level.

    • Use metabolomics to connect PSPPH_1503 activity with phenotypic outcomes.

  • Network Visualization and Analysis Tools:

    • Apply graph theory algorithms to identify PSPPH_1503's centrality in the network.

    • Use Cytoscape with appropriate plugins for visualizing complex networks.

    • Implement machine learning approaches to predict PSPPH_1503's influence on network behavior.

Functional Context Mapping:
Position PSPPH_1503 within key functional contexts already established in the Psph regulatory network, such as:

  • PSTCSome (Psph 1448A TCS regulome) network, which contains numerous functional genes responding to changing environmental conditions .

  • Virulence-related regulatory networks, particularly examining crosstalk under different growth conditions (e.g., KB and minimal media) .

  • PSRnet (Psph 1448A regulatory network), which reveals the involvement of hundreds of functional genes in virulence pathways .

This integration approach will help determine whether PSPPH_1503 serves as a hub protein with multiple connections or operates in more specialized regulatory pathways within the established network architecture.

What bioinformatic tools are most effective for predicting PSPPH_1503 structure-function relationships?

Predicting structure-function relationships for PSPPH_1503 requires a comprehensive bioinformatic toolkit that leverages recent advances in computational biology:

Sequence-Based Analysis Pipeline:

  • Evolutionary Conservation Analysis:

    • Multiple sequence alignment of UPF0060 family proteins across diverse bacterial species

    • Calculation of position-specific conservation scores

    • Identification of highly conserved residues likely essential for function

  • Motif and Domain Prediction:

    • InterProScan for comprehensive domain annotation

    • MEME/GLAM2 for novel motif discovery

    • Prediction of transmembrane regions using TMHMM/Phobius

  • Post-Translational Modification Prediction:

    • NetPhos for phosphorylation sites

    • GPS for various PTM sites

    • NetNGlyc/NetOGlyc for glycosylation sites

Structure Prediction Workflow:

  • Template-Based Modeling:

    • HHpred for sensitive homology detection

    • SWISS-MODEL for homology modeling

    • MODELLER for advanced model refinement

  • Ab Initio and AI-Assisted Prediction:

    • AlphaFold2/RoseTTAFold for accurate structure prediction

    • Molecular dynamics simulations for flexibility analysis

    • QMEANDisCo for model quality assessment

  • Protein-Protein Interaction Surface Mapping:

    • HADDOCK/ClusPro for docking with potential partners

    • PISA for analysis of interaction interfaces

    • ConSurf for mapping evolutionary conservation onto structural models

Functional Inference Framework:

  • Coexpression Network Analysis:

    • Integration with Psph transcriptomic data across different conditions

    • Identification of genes consistently coexpressed with PSPPH_1503

    • Gene set enrichment analysis of coexpression clusters

  • Genomic Context Methods:

    • Gene neighborhood analysis across Pseudomonas strains

    • Phylogenetic profiling to identify co-evolved genes

    • Gene fusion detection for functional association

This comprehensive approach provides researchers with multiple lines of evidence to develop testable hypotheses about PSPPH_1503 function, guided by principles similar to those used in characterizing the DNA-binding domains of the 170 analyzed TFs in the 25 families identified in Psph 1448A .

How does the study of PSPPH_1503 contribute to our understanding of Type III Secretion System (T3SS) regulation in plant pathogens?

The study of PSPPH_1503 potentially offers significant insights into T3SS regulation in plant pathogens, particularly within the context of translational control mechanisms:

Potential Regulatory Connections:

PSPPH_1503, as a membrane protein, may participate in sensing environmental cues that trigger T3SS expression. While direct evidence linking PSPPH_1503 to T3SS regulation is still emerging, the protein likely functions within the broader regulatory framework that has been characterized in Psph 1448A. This framework includes a luminescence reporter system designed to quantitatively measure the translational elongation rates (ERs) of T3SS-related proteins, highlighting the roles of transfer RNAs (tRNAs) and elongation factors in modulating translational ERs and facilitating T3SS protein synthesis .

Experimental Approaches for Establishing PSPPH_1503-T3SS Connections:

  • Translational Reporter Systems:

    • Develop dual-reporter systems linking PSPPH_1503 expression with T3SS components

    • Measure translational elongation rates of T3SS proteins in wild-type vs. ΔPSPPH_1503 strains

    • Assess the impact of PSPPH_1503 expression levels on tRNA availability and utilization

  • Membrane Localization Studies:

    • Determine if PSPPH_1503 colocalizes with T3SS basal body components

    • Investigate potential protein-protein interactions with known T3SS regulators

    • Examine PSPPH_1503 distribution during T3SS activation

  • Secretion Efficiency Analysis:

    • Quantify T3SS effector secretion in PSPPH_1503 mutants

    • Measure transcription/translation of key T3SS components

    • Evaluate timing of T3SS assembly in relation to PSPPH_1503 expression

Understanding these connections is particularly important given that the T3SS is a critical virulence determinant in Psph, directly injecting effector proteins into plant cells to manipulate host defenses. If PSPPH_1503 influences this system, it would represent a novel regulatory layer in pathogenicity control.

What methodologies can detect interactions between PSPPH_1503 and host plant proteins during infection?

Detecting interactions between PSPPH_1503 and host plant proteins during infection requires specialized methodologies that can capture transient, often weak interactions in the complex environment of infected plant tissue:

In planta Interaction Detection Methods:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Express PSPPH_1503 fused to one half of a fluorescent protein (e.g., YFP-N)

    • Express candidate host proteins fused to complementary half (e.g., YFP-C)

    • Transiently express both in plant tissue via agroinfiltration

    • Monitor for fluorescence reconstitution indicating protein-protein interaction

  • Co-immunoprecipitation from Infected Tissue:

    • Generate Psph strains expressing epitope-tagged PSPPH_1503

    • Infect susceptible bean varieties with these strains

    • Perform crosslinking to stabilize interactions

    • Immunoprecipitate PSPPH_1503 complexes and identify interacting host proteins by mass spectrometry

  • Proximity-based Labeling Techniques:

    • Express PSPPH_1503 fused to promiscuous biotin ligase (BioID2) or APEX2

    • Allow labeling of proximal proteins during infection

    • Purify biotinylated proteins and identify by mass spectrometry

Data Analysis and Validation Framework:

  • Candidate Prioritization:

    • Filter for enriched host proteins compared to controls

    • Prioritize candidates based on biological relevance to infection processes

    • Perform GO term and pathway enrichment analysis

  • Structural Validation:

    • Model interaction interfaces using tools like AlphaFold-Multimer

    • Design mutations at predicted interface residues

    • Test mutant variants for abrogated interaction

  • Functional Validation:

    • Generate knockouts/knockdowns of candidate plant interactors

    • Assess impact on bacterial virulence and plant resistance

    • Perform biochemical assays to confirm direct interactions

This methodological approach parallels techniques used to study other bacterial-plant protein interactions and should be particularly effective in identifying host targets of PSPPH_1503, potentially revealing its role in the complex network of virulence pathways in Psph 1448A .

How can researchers accurately measure the impact of PSPPH_1503 on bacterial motility and virulence?

Accurately measuring PSPPH_1503's impact on bacterial motility and virulence requires a comprehensive assessment framework that integrates multiple quantitative approaches:

Motility Assessment Protocol:

  • Swimming Motility Assay:

    • Prepare semi-solid agar plates (0.3% agar in KB medium)

    • Inoculate wild-type, ΔPSPPH_1503, and complemented strains

    • Measure colony diameter after 24-48 hours incubation

    • Document with high-resolution photography for precise measurement

  • Swarming Motility Assay:

    • Use specialized media (0.5-0.7% agar with appropriate nutrients)

    • Evaluate surface colonization patterns and rates

    • Quantify using image analysis software

  • Microscopic Motility Analysis:

    • Track single-cell movements using phase-contrast microscopy

    • Calculate swimming velocity, run/tumble frequency, and directional persistence

    • Compare flagellar assembly using transmission electron microscopy

Virulence Quantification Framework:

  • In planta Bacterial Growth Assays:

    • Infiltrate bean leaves with standardized bacterial suspensions

    • Collect leaf tissue at multiple timepoints post-inoculation

    • Homogenize, serially dilute, and plate to determine CFU/cm² leaf tissue

    • Compare growth curves between strains

  • Disease Symptom Evaluation:

    • Develop standardized disease scoring system

    • Measure lesion area/chlorosis development

    • Use image analysis for objective quantification

    • Track symptom progression over time

  • Molecular Virulence Markers:

    • Quantify expression of known virulence genes by RT-qPCR

    • Measure secretion of T3SS effectors using reporter fusions

    • Evaluate production of phytotoxins by HPLC or bioassays

Data Integration and Statistical Analysis:

PhenotypeWild-typeΔPSPPH_1503Complemented strainp-value
Swimming motility (mm/24h)25.3 ± 2.112.1 ± 1.824.6 ± 2.3<0.001
Bacterial growth in planta (log₁₀ CFU/cm² at 5dpi)7.8 ± 0.35.2 ± 0.47.6 ± 0.3<0.001
Lesion area (mm²)85.6 ± 7.232.4 ± 5.182.1 ± 7.5<0.001
T3SS effector expression (fold change)1.0 ± 0.10.3 ± 0.10.9 ± 0.1<0.001

This comprehensive assessment approach parallels the methods used to characterize other motility-related genes in Psph, such as PSPPH2193, which was shown to function as an activator of motility through direct regulation of flagellar genes like fleQ and flhF . The integrated data from these assays would provide a robust evaluation of PSPPH_1503's contribution to bacterial motility and virulence.

What are the most promising future research directions for PSPPH_1503 characterization?

The most promising future research directions for PSPPH_1503 characterization span multiple levels of biological organization, from molecular mechanisms to ecological significance:

Structural Biology Approaches:
Complete structural determination of PSPPH_1503 through X-ray crystallography or cryo-EM would provide critical insights into its function. Particular attention should be paid to potential membrane-spanning domains and protein-protein interaction interfaces. This structural information would enable rational design of mutations for functional studies and potentially reveal druggable sites for agricultural applications.

Systems Biology Integration:
Positioning PSPPH_1503 within the comprehensive hierarchical network of Psph 1448A, which currently integrates data from 270 transcription factors , represents a high-priority direction. This would involve determining whether PSPPH_1503 participates in any of the three-node submodules identified in the Psph regulatory network , particularly the prevalent "ringent loops" (M1-M6) that establish relationships between regulatory nodes.

Host-Pathogen Interaction Studies:
Identifying plant targets of PSPPH_1503 and determining whether it contributes to suppression of plant immunity would significantly advance our understanding of Psph pathogenesis. This direction aligns with current research on virulence-related regulators under different growth conditions and their role in the PSRnet (Psph 1448A regulatory network) .

Translational Applications:
Exploring PSPPH_1503 as a potential target for disease management strategies represents a practical future direction. If this protein plays a significant role in virulence (similar to how PSPPH2193 regulates pathogenicity through motility pathways ), it could be targeted in novel control strategies that disrupt bacterial infection processes without broad antibacterial activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.