Recombinant Pseudomonas syringae pv. syringae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Physiology

ATP synthase subunit a (AtpB) is integral to the F0 sector of the ATP synthase complex, which forms a proton channel across the bacterial membrane. This enables proton gradient-driven ATP synthesis, critical for energy metabolism in P. syringae . Comparative genomic studies highlight its conservation across P. syringae pathovars, with variations in operon organization influencing strain-specific adaptations to environmental stressors .

Research Applications

  • Enzyme Kinetics Studies: Used to investigate ATP synthase function and inhibition mechanisms in pathogenic bacteria .

  • Antibody Development: Serves as an antigen for generating antibodies to study ATP synthase localization and expression in P. syringae .

  • Comparative Genomics: Provides insights into evolutionary divergence between P. syringae pathovars, such as syringae and tomato DC3000, which differ in host specificity and virulence strategies .

Future Directions

Further research could explore:

  • Structural analysis of AtpB to identify potential drug targets against bacterial blight.

  • Role of ATP synthase in mediating interactions between P. syringae and host plants during infection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development to meet your specifications.
Synonyms
atpB; Psyr_5127; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
atpB
Target Protein Sequence
MAEQTASGYIQHHLQNLTFGHLPNGEWGFAHTAAEAKEMGFWAFHVDTLGWSVALGLIFV LIFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSAVIAPLALTIFVWVFLMNA VDLVPVDWIPQLAMMISGDSHIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIGGFI GELTLHPFGSKNLFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit a (atpB) in Pseudomonas syringae pv. syringae and why is it significant?

ATP synthase subunit a (atpB) is a critical component of the F1F0-ATP synthase complex in Pseudomonas syringae pv. syringae, playing an essential role in energy metabolism. This membrane-embedded protein forms part of the proton channel within the F0 sector of the enzyme complex, facilitating proton translocation across the membrane that drives ATP synthesis. The significance of atpB lies in its fundamental role in bacterial bioenergetics, providing the energy currency necessary for numerous cellular processes including pathogenicity mechanisms. Research into recombinant forms of this protein enables detailed structural and functional analyses that contribute to our understanding of P. syringae metabolism and potential therapeutic targets.

How does atpB contribute to P. syringae pathogenicity and plant-pathogen interactions?

The atpB protein contributes to pathogenicity primarily through its role in energy production, which underpins virulence factor expression and secretion. ATP generated by the ATP synthase complex provides the energy required for the production and operation of the type III secretion system (T3SS), which is crucial for delivering effector proteins into host cells . Furthermore, ATP synthase activity enables P. syringae to adapt to various microenvironments encountered during plant colonization, including acidic apoplastic spaces and nutrient-limited conditions. Evidence suggests that metabolic adaptations, including those involving ATP synthase, are coordinated with virulence factor deployment during different stages of infection . Research into horizontal gene transfer mechanisms in P. syringae has revealed that energy metabolism genes, though generally more conserved than virulence factors, may undergo recombination events that contribute to adaptive evolution .

What are the structural characteristics of atpB that should be considered when designing expression systems?

When designing expression systems for P. syringae atpB, several structural characteristics require special consideration. First, atpB is a membrane protein with multiple transmembrane domains that can cause expression challenges due to hydrophobicity and potential toxicity to host cells. Second, the protein forms part of a multi-subunit complex, meaning its native conformation depends on interactions with other ATP synthase components. Third, proper folding may require specific lipid environments not available in conventional expression systems.

These characteristics necessitate specialized approaches, including: (1) fusion with solubility-enhancing tags; (2) expression at reduced temperatures to facilitate proper folding; (3) consideration of specialized membrane protein expression systems; and (4) potentially employing secretion-based systems like the P. aeruginosa type III secretion system, which has been shown to effectively produce soluble, properly folded recombinant proteins . Additionally, codon optimization for the expression host and careful selection of detergents for extraction and purification steps are critical for maintaining protein integrity.

What expression systems have proven most effective for producing functional recombinant atpB?

The optimal expression system for recombinant atpB depends on research objectives and downstream applications. Conventional E. coli BL21(DE3) systems remain widely used due to their high yield potential and established protocols, but often result in inclusion body formation requiring refolding steps. For improved solubility and functionality, several specialized systems have shown promise:

The P. aeruginosa type III secretion system represents a particularly effective alternative for producing soluble, correctly folded proteins. As described in research by High et al., this system facilitates protein secretion directly into the culture medium, allowing proper folding in an oxidative environment and avoiding inclusion body formation . The CHA-OST strain with deletions in toxin-encoding genes, combined with the pEAI-S54 plasmid, has demonstrated successful secretion of various recombinant proteins with confirmed biological activity .

For membrane proteins like atpB, cell-free expression systems or specialized E. coli strains engineered for membrane protein expression (such as C41/C43) may provide advantages by avoiding toxicity issues. Additionally, expression in RPMI mammalian cell cultivation media has been shown to reduce contamination and facilitate downstream processing for proteins expressed using the P. aeruginosa secretion system .

What optimization strategies can improve solubility and yield of recombinant atpB protein?

Improving solubility and yield of recombinant atpB requires systematic optimization of multiple parameters. Based on established protein expression principles and the specialized nature of membrane proteins like atpB, the following strategies are recommended:

  • Expression conditions optimization:

    • Reduce induction temperature to 16-20°C, which slows protein synthesis and allows more time for proper folding

    • Decrease inducer concentration to reduce expression rate

    • Optimize inducer timing based on culture density (typically mid-log phase)

    • Extend expression time at lower temperatures (overnight expression)

  • Genetic modifications:

    • Fusion with solubility-enhancing tags (MBP, SUMO, TRX, or fluorescent proteins like EGFP/mCherry)

    • Co-expression with molecular chaperones to facilitate proper folding

    • Addition of secretion signals when using secretion-based systems like the P. aeruginosa type III secretion system

    • Use of TAT-HA (trans-activator of transduction-hemagglutinin) tags, which have been shown to improve protein transduction across membranes

  • Buffer optimization:

    • Include appropriate detergents for membrane protein solubilization

    • Add stabilizing agents (glycerol, specific lipids, or mild reducing agents)

    • Optimize salt concentration to maintain protein stability

For the P. aeruginosa secretion system approach, using defined media (such as RPMI) can facilitate downstream processing and reduce contamination, as demonstrated in the expression of fusion proteins with the ExoS54 secretion signal .

How can post-translational modifications affect recombinant atpB function, and how should these be addressed?

Post-translational modifications (PTMs) can significantly impact the functionality of recombinant atpB. Although bacterial proteins generally undergo fewer PTMs than eukaryotic proteins, several modifications can affect atpB structure and function:

  • Oxidation states: Improper disulfide bond formation can disrupt protein structure. Expression in oxidizing environments (like the extracellular space in the P. aeruginosa type III secretion system) can facilitate appropriate disulfide bonding . This system allows proteins to be secreted into an oxidative environment where they can fold more effectively with appropriate disulfide bonds .

  • Proteolytic processing: Unintended cleavage can occur during expression or purification. This can be mitigated by:

    • Using protease-deficient expression strains

    • Including protease inhibitors during purification

    • Optimizing buffer conditions to minimize proteolysis

  • Membrane insertion: As a membrane protein, atpB requires proper insertion into lipid bilayers for full functionality. When studying activity, consider:

    • Reconstitution into liposomes or nanodiscs after purification

    • Using detergent micelles that maintain native-like environments

    • Evaluating different detergent types for optimal activity preservation

  • Phosphorylation: While less common in bacterial systems, potential phosphorylation sites should be considered when analyzing functional differences between native and recombinant proteins.

Validation of proper folding can be accomplished through circular dichroism spectroscopy, limited proteolysis patterns, and functional assays that compare activity with native ATP synthase complexes.

What purification strategies yield the highest purity and activity for recombinant atpB?

Purifying recombinant atpB to high levels of purity while maintaining activity requires a carefully designed strategy that accounts for its membrane protein nature. Based on current methodologies for similar proteins, an effective purification workflow includes:

  • Initial extraction and solubilization:

    • For intracellular expression: Cell lysis followed by membrane fraction isolation

    • For secretion-based systems: Direct processing of culture supernatant

    • Careful selection of detergents (typically mild non-ionic detergents like DDM or LMNG)

  • Primary purification:

    • Immobilized Metal Affinity Chromatography (IMAC) using Ni-nitrilotriacetic acid (Ni-NTA) columns for His-tagged constructs

    • Optimization of imidazol gradient elution to separate specifically bound protein from non-specific binders

    • Buffer composition optimization to maintain protein stability

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and further purify monomeric protein

    • Ion exchange chromatography as appropriate based on protein properties

For the P. aeruginosa secretion system approach, the protocol can be simplified as proteins are secreted directly into the medium, reducing cellular contaminants . The use of defined media like RPMI has been shown to facilitate downstream processing and reduce contamination . Additionally, for fusion proteins containing fluorescent tags like EGFP or mCherry, monitoring purification via fluorescence provides a convenient method to track protein through purification steps .

What analytical techniques are most effective for verifying the structural integrity and function of purified atpB?

Comprehensive characterization of recombinant atpB requires multiple complementary analytical techniques:

When using fluorescent fusion constructs (EGFP/mCherry), additional verification can be performed through fluorescence-based techniques, including microscopy to confirm proper folding of the fluorescent domain . For proteins produced using the P. aeruginosa secretion system, activity assays performed directly on secreted proteins have demonstrated that this approach yields properly folded and functional proteins .

How can I accurately quantify recombinant atpB protein concentration and purity?

Accurate quantification and purity assessment of recombinant atpB requires multiple complementary methods due to the challenging nature of membrane proteins:

  • Protein concentration determination:

    • BCA or Bradford assays with appropriate standard curves

    • Amino acid analysis for absolute quantification

    • UV absorption at 280 nm with calculated extinction coefficients

    • For fluorescent fusion proteins, fluorescence intensity can provide an additional quantification method

  • Purity assessment:

    • Densitometry analysis of SDS-PAGE gels (Coomassie or silver stained)

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Capillary electrophoresis

    • Mass spectrometry for detection of contaminants and degradation products

  • Functional purity:

    • Specific activity measurements (activity per mg protein)

    • Comparison with reference standards of known purity

    • Ratio of ATP hydrolysis activity to protein concentration

A reliable approach combines protein-specific assays (western blotting) with general protein quantification methods to establish both absolute concentration and relative purity. For proteins expressed using the P. aeruginosa type III secretion system, higher initial purity can be expected as proteins are secreted directly into the medium, potentially simplifying quantification steps . When including tags like 6×His along with fluorescent proteins, multiple quantification methods can be employed simultaneously for cross-validation .

What are common challenges in recombinant atpB expression and how can they be overcome?

Recombinant expression of membrane proteins like atpB presents numerous challenges that require specific troubleshooting approaches:

  • Toxicity to expression host:

    • Challenge: Expression of membrane proteins can disrupt host cell membrane integrity

    • Solution: Use tightly regulated promoters, lower induction levels, or specialized expression strains

    • Alternative: Consider the P. aeruginosa type III secretion system, which secretes proteins outside the cell, reducing toxicity issues

  • Inclusion body formation:

    • Challenge: Hydrophobic membrane proteins often aggregate into insoluble inclusion bodies

    • Solution: Lower expression temperature (16-20°C), use solubility-enhancing fusion partners

    • Alternative: The secretion-based P. aeruginosa system has been shown to produce soluble proteins directly in the culture medium, avoiding inclusion body formation

  • Poor yield:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Optimize codons for expression host, adjust media composition, extend expression time

    • Alternative: Concentrate proteins from culture supernatant when using secretion systems

  • Improper folding:

    • Challenge: Complex folding requirements of membrane proteins

    • Solution: Co-express with chaperones, include specific lipids or stabilizing agents

    • Alternative: Exploit the oxidative extracellular environment of secretion systems that facilitates proper folding

  • Proteolytic degradation:

    • Challenge: Partially folded membrane proteins are susceptible to proteolysis

    • Solution: Use protease-deficient strains, include protease inhibitors, optimize buffer conditions

    • Alternative: For the P. aeruginosa system, use strains like CHA-OST with deletions in specific toxins to improve protein integrity

The P. aeruginosa type III secretion system offers a particularly effective solution to many of these challenges by allowing proteins to fold in an extracellular environment and avoiding the complications of intracellular expression .

What controls should be included in experiments using recombinant atpB protein?

Rigorous experimental design for recombinant atpB research requires appropriate controls at each stage:

  • Expression and purification controls:

    • Negative control: Expression host transformed with empty vector processed identically

    • Positive control: Well-characterized protein expressed and purified using the same protocol

    • Purification control: Mock purification from non-induced cultures

  • Structural integrity controls:

    • Thermally denatured atpB samples to establish baseline for unfolded protein

    • Native ATP synthase preparations (commercial or lab-isolated) for comparison

    • Size exclusion profiles to monitor oligomeric state and aggregation

  • Functional assay controls:

    • Known ATP synthase inhibitors (oligomycin, DCCD) to confirm specificity of activity

    • Heat-inactivated samples to establish baseline for non-functional protein

    • Commercially available F1-ATPase as activity reference standard

  • Interaction studies controls:

    • Non-specific binding controls (e.g., BSA, irrelevant membrane proteins)

    • Competition assays with unlabeled protein

    • Mutated versions of atpB with altered binding sites

For fluorescent fusion proteins, additional controls should include: unfused fluorescent protein to account for tag-specific effects, and photobleaching controls for microscopy experiments . When using the P. aeruginosa secretion system, control experiments should include analysis of culture supernatant from strains expressing the secretion signal alone without the protein of interest .

How can I confirm the functionality of recombinant atpB in isolation from the complete ATP synthase complex?

  • Partial function assays:

    • Proton channel activity in reconstituted systems using pH-sensitive dyes

    • Binding assays with purified partner subunits from the ATP synthase complex

    • Structural transitions in response to pH changes or inhibitor binding

  • Complementation approaches:

    • Reconstitution with other purified ATP synthase components to restore partial complex functionality

    • Genetic complementation in atpB-deficient bacterial strains

    • Dominant negative effects when introduced to wild-type systems

  • Biophysical characterization:

    • Conformational changes monitored by fluorescence spectroscopy or FRET

    • Thermal stability shifts in the presence of binding partners or inhibitors

    • Structural integrity analysis by limited proteolysis patterns

  • Integration into artificial systems:

    • Reconstitution into liposomes or nanodiscs with ion conductance measurements

    • Construction of minimal functional units with key interacting subunits

When using fluorescent fusion proteins as described in current protocols, fluorescence properties can provide additional information about protein folding and conformational states . For proteins expressed using the P. aeruginosa secretion system, activity has been demonstrated for various secreted proteins, suggesting this approach can yield properly folded and functional proteins .

How can recombinant atpB be used to study P. syringae pathogenicity mechanisms?

Recombinant atpB provides a valuable tool for investigating multiple aspects of P. syringae pathogenicity:

  • Metabolic adaptation studies:

    • Examine how atpB variants affect ATP production during different stages of infection

    • Investigate energy requirements for virulence factor expression and secretion

    • Study metabolic adaptations to plant defense responses

  • Host-pathogen interaction analysis:

    • Identify potential recognition of atpB by plant immune receptors

    • Investigate if atpB undergoes modifications during infection

    • Examine correlations between atpB sequence variations and host range across pathovars

  • Evolutionary studies:

    • Analyze recombination patterns in atpB across different P. syringae lineages

    • Compare with patterns observed in virulence factors like type III secreted effectors

    • Investigate how core genome recombination, which may include atpB, contributes to pathogen emergence

Research has shown that P. syringae undergoes genome-wide homologous recombination that affects core metabolic functions, including ATP-dependent transport and metabolism pathways . While not specifically focused on atpB, studies have demonstrated that recombination in metabolic genes can occur alongside horizontal gene transfer of virulence factors, potentially contributing to pathogen adaptation and host range . The integration of recombinant atpB studies with broader genomic analyses could reveal how energy metabolism adaptations coordinate with virulence factor acquisition during pathogen evolution.

What insights can structural analysis of recombinant atpB provide for antimicrobial development?

Structural characterization of recombinant atpB offers significant potential for antimicrobial development through several research avenues:

  • Identification of bacterial-specific features:

    • Detailed structural analysis can reveal differences between bacterial and host ATP synthases

    • These differences can be exploited to design selective inhibitors

    • Comparison across pathovars may identify conserved bacterial-specific regions as broad-spectrum targets

  • Structure-based drug design:

    • High-resolution structures enable rational design of molecules that interfere with atpB function

    • Virtual screening against identified binding pockets

    • Fragment-based approaches to develop novel inhibitor scaffolds

  • Interaction interface mapping:

    • Characterization of interfaces between atpB and other ATP synthase subunits

    • Design of peptides or small molecules that disrupt complex assembly

    • Identification of allosteric sites that could modulate function

  • Comparative analysis with resistant strains:

    • Structural changes in atpB associated with resistance to known ATP synthase inhibitors

    • Identification of resistance mechanisms through structural biology

    • Design of next-generation inhibitors that overcome resistance

Studies on P. aeruginosa have demonstrated how proteomic responses to antibiotics can reveal novel resistance mechanisms , suggesting similar approaches could be valuable for P. syringae. Techniques for producing recombinant proteins with various tags (including fluorescent proteins) enable sophisticated structural and functional studies . The P. aeruginosa type III secretion system offers particularly promising approaches for producing properly folded proteins that maintain their native structure and activity, facilitating more accurate structural studies .

How does recombinant atpB research contribute to understanding bacterial evolution and adaptation?

Recombinant atpB research provides valuable insights into bacterial evolution and adaptation through multiple research dimensions:

  • Evolutionary patterns analysis:

    • Comparison of atpB sequences across P. syringae pathovars reveals evolutionary pressures

    • Analysis of synonymous vs. non-synonymous mutations indicates selection intensity

    • Identification of conserved vs. variable regions suggests functional constraints

  • Recombination and horizontal gene transfer:

    • Studies show that ATP-dependent transport and metabolism pathways in P. syringae are enriched for recombination events

    • Core genome recombination, potentially including genes like atpB, contributes to pathogen emergence

    • Comparative analysis reveals how metabolic gene evolution coordinates with virulence factor acquisition

  • Host adaptation mechanisms:

    • Functional characterization of atpB variants from different pathovars reveals adaptations to specific plant hosts

    • Recombinant protein studies can link structural variations to functional differences

    • Expression studies show how atpB regulation may differ during infection of different hosts

Research has demonstrated that P. syringae undergoes genome-wide homologous recombination between phylogroups, with pathways involved in ATP-dependent transport and metabolism being enriched for recombination events . This indicates that genes related to energy metabolism, potentially including atpB, play important roles in pathogen adaptation and evolution. Furthermore, a positive correlation has been observed between the proportion of recent recombination in the core genome and the acquisition of virulence factors through horizontal gene transfer , highlighting the interplay between metabolic adaptation and virulence evolution.

How does P. syringae atpB compare structurally and functionally with homologs in other bacterial species?

Comparative analysis of P. syringae atpB with homologs in other bacterial species reveals important evolutionary and functional relationships:

Table 1: Comparative Analysis of atpB Among Bacterial Species

SpeciesSequence Similarity to P. syringae atpB (%)Key Structural DifferencesFunctional Implications
P. aeruginosa85-90More variable C-terminal regionAdaptations to diverse environments including mammalian hosts
E. coli70-75Differences in proton channel residuesModel system for structural studies with established protocols
Xanthomonas spp.75-80Similar plant pathogen adaptationsConvergent evolution in plant-associated niches
Rhizobium spp.65-70Adaptations for symbiotic lifestyleContrasting role in beneficial plant interactions

The ATP synthase in P. syringae shares core catalytic mechanisms with other bacterial species but exhibits specific adaptations related to its plant pathogen lifestyle. Studies utilizing the P. aeruginosa type III secretion system have demonstrated that proteins can be secreted in active form, suggesting potential for comparative functional studies . This approach could be valuable for expressing atpB variants from different species to compare their properties.

Research on horizontal gene transfer in P. syringae has revealed that core genome recombination affects ATP-dependent transport and metabolism pathways , suggesting that even relatively conserved proteins like atpB may contribute to adaptation through subtle sequence variations. These comparative studies provide insights into how metabolic adaptations coordinate with pathogenicity mechanisms across bacterial species.

What emerging technologies will shape future research on recombinant atpB?

The future of recombinant atpB research will be influenced by several cutting-edge technologies:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structures without crystallization

    • Integrative structural biology combining multiple data sources

    • In-cell structural studies to examine native conformations

  • Protein engineering innovations:

    • De novo design of simplified ATP synthase components

    • Directed evolution to generate atpB variants with novel properties

    • Non-canonical amino acid incorporation for specialized functional studies

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational dynamics

    • Optical tweezers to study mechanical properties

    • Nanopore recordings of single channel activity

  • Advanced expression systems:

    • Further refinement of secretion-based systems like the P. aeruginosa type III secretion system

    • Cell-free expression systems optimized for membrane proteins

    • Synthetic minimal cells for functional reconstitution

  • Multi-omics integration:

    • Similar to approaches used in P. aeruginosa studies

    • Systems biology models incorporating metabolic, proteomic, and genomic data

    • Machine learning to predict functional consequences of sequence variations

The development of improved fluorescent tagging methods, as described in current protocols , will facilitate sophisticated imaging studies. Additionally, refinements to the P. aeruginosa secretion system will continue to provide advantages for producing properly folded, active proteins for functional and structural studies .

What are the most pressing unanswered questions regarding atpB in P. syringae pathogenicity?

Several critical knowledge gaps remain regarding atpB's role in P. syringae pathogenicity:

  • Regulatory mechanisms:

    • How is atpB expression regulated during different stages of plant infection?

    • Do plant signals directly influence ATP synthase activity?

    • Is there coordinated regulation between energy metabolism and virulence factor expression?

  • Host-specific adaptations:

    • Do atpB sequence variations correlate with host range across different pathovars?

    • How do plant defense responses specifically target or affect ATP synthase function?

    • Are there host-specific energy requirements during infection of different plant species?

  • Evolutionary dynamics:

    • How does horizontal gene transfer and recombination in other genes affect atpB function?

    • What is the evolutionary relationship between metabolic adaptation and virulence factor acquisition?

    • Do recombination events in ATP-dependent transport and metabolism genes directly impact pathogenicity?

  • Therapeutic potential:

    • Can atpB-specific inhibitors effectively control P. syringae infections?

    • What are the resistance mechanisms against ATP synthase inhibitors?

    • How can host specificity be engineered into ATP synthase-targeting treatments?

Studies on P. syringae have shown that genome-wide homologous recombination affects metabolic pathways, including ATP-dependent transport , but the specific consequences for ATP synthase function and pathogenicity remain unclear. Research revealing the interplay between homologous recombination and horizontal gene transfer in pathogen emergence suggests complex evolutionary dynamics that merit further investigation. Additionally, proteomic approaches similar to those used in P. aeruginosa antibiotic response studies could reveal how ATP synthase components respond to plant defense mechanisms.

What best practices should researchers follow when working with recombinant P. syringae atpB?

Researchers working with recombinant P. syringae atpB should adhere to several best practices to ensure reliable and reproducible results:

  • Expression system selection:

    • Choose systems based on specific research objectives

    • Consider specialized approaches like the P. aeruginosa type III secretion system for obtaining soluble, correctly folded protein

    • Validate protein functionality through multiple complementary assays

  • Experimental design:

    • Include appropriate controls at each experimental stage

    • Implement rigorous validation of protein identity, purity, and activity

    • Document all experimental conditions comprehensively

  • Purification strategies:

    • Optimize detergent selection for membrane protein extraction

    • Use multistep purification protocols to ensure high purity

    • Verify structural integrity through multiple analytical techniques

  • Functional characterization:

    • Assess activity through both direct and indirect methods

    • Compare with native ATP synthase when possible

    • Consider reconstitution approaches to study membrane-associated functions

  • Data reporting:

    • Provide complete methodological details to ensure reproducibility

    • Report yields, purity levels, and specific activity measurements

    • Deposit structural data in appropriate databases

Following these practices will contribute to a more robust understanding of atpB's role in P. syringae biology and pathogenicity, building on insights from studies of recombinant protein production and pathogen evolution mechanisms .

How can findings from recombinant atpB research be translated into practical applications?

Research on recombinant P. syringae atpB has significant translational potential across multiple domains:

  • Agricultural applications:

    • Development of targeted antimicrobials for crop protection

    • Diagnostic tools for early detection of P. syringae infections

    • Breeding programs for crops with enhanced resistance to ATP synthase-targeting toxins

  • Biotechnological innovations:

    • Engineering of modified ATP synthases for bioenergy applications

    • Development of biosensors based on ATP synthase activity

    • Creation of biomimetic energy-generating systems

  • Fundamental research tools:

    • Improved methods for membrane protein expression and characterization

    • Refined protocols for functional reconstitution of complex membrane protein assemblies

    • New approaches for studying protein-protein interactions within multi-subunit complexes

  • Therapeutic development:

    • Structure-based design of selective inhibitors targeting bacterial ATP synthases

    • Novel strategies to combat antimicrobial resistance

    • Cross-species applications for related human pathogens

The refinement of protocols for recombinant protein production, including the P. aeruginosa type III secretion system approach and advanced tagging strategies , provides valuable methodological frameworks that can accelerate translation. Additionally, insights into horizontal gene transfer and recombination mechanisms inform evolutionary considerations critical for developing durable agricultural solutions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.