Recombinant Pseudomonas syringae pv. syringae Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Psyr_3672; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
cobS
Target Protein Sequence
MLPFWIALQFLGSLPIRLPGMPSPEELGRSLLFYPLVGAVFGTLLLGFNTLLSGAPLMLH AALVLTAWVLLSGGLHLDGLADSADAWLGGFGDRERTLKIMKDPRSGPIAVVTLVLVLLL KFAAILALIESHASVWLLLAPVIGRAAMLGLFLGTPYVRSGGLGQALADHLPRGPGRKVL LATAIACVLLAGWSGVAVLLVCAVCFFWLRQLMMRRLGGCTGDTAGALLELLELAVLLTL ALL
Uniprot No.

Target Background

Function
Catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas syringae pv. syringae Cobalamin synthase (CobS) and what is its primary function?

Cobalamin synthase (CobS) from Pseudomonas syringae pv. syringae is an enzyme involved in the biosynthesis of vitamin B12 (cobalamin). Its primary function is to catalyze a key step in the assembly of the nucleotide loop of cobalamin. Specifically, CobS functions as a cobalamin-5'-phosphate synthase, catalyzing the addition of the lower nucleotide loop to adenosylcobinamide-GDP to form adenosylcobalamin-5'-phosphate (AdoCbl-5'-P) . This enzyme is part of a broader pathway that includes other enzymes such as CobU, CobT, and CobC, which collectively synthesize the complete cobalamin molecule. Interestingly, CobS can use α-ribazole-5'-phosphate as a substrate in the absence of the CobC phosphatase enzyme, demonstrating its functional flexibility in the cobalamin biosynthetic pathway .

What structural and functional domains characterize the CobS protein?

The CobS protein contains specific domains that enable its function as a cobalamin synthase. While the search results don't provide explicit structural information about P. syringae CobS, research on homologous proteins suggests it likely contains nucleotide-binding domains for interaction with adenosylcobinamide-GDP and α-ribazole-5'-phosphate. The enzyme must possess specific binding sites for these substrates and catalytic residues that facilitate the formation of the glycosidic bond between them. The protein's structure is likely optimized to recognize and process specifically the lower nucleotide component of cobalamin, which in standard vitamin B12 contains dimethylbenzimidazole .

What are the optimal conditions for recombinant expression of P. syringae CobS?

For recombinant expression of P. syringae CobS, researchers have utilized several approaches based on established protocols for similar proteins. Based on the methodology described in the search results for related proteins, an effective expression system would likely include:

  • Vector selection: A suitable expression vector such as pT7-7 or pUCP24 derivatives with an appropriate promoter system

  • Expression host: E. coli strains optimized for protein expression (BL21(DE3) or similar)

  • Induction conditions: IPTG induction at mid-log phase (OD600 of 0.6-0.8)

  • Growth temperature: Reduced temperature (16-25°C) post-induction to enhance soluble protein production

  • Growth medium: Rich media such as LB or 2xYT supplemented with appropriate antibiotics

As evidenced by similar studies, the CobS protein can be expressed with a histidine tag to facilitate purification, as done with the "(His)6CobS preparation" mentioned in the research on the Salmonella enzyme .

What purification strategies yield the highest purity and activity for recombinant CobS?

Based on the strategies used for similar enzymes, the following purification approach would likely yield high-purity, active recombinant CobS:

Purification StepMethodBuffer CompositionExpected Result
Initial CaptureNi-NTA affinity chromatography50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole gradient>80% purity
Intermediate PurificationIon exchange chromatography20 mM Tris-HCl pH 8.0, 0-500 mM NaCl gradient>90% purity
PolishingSize exclusion chromatography20 mM Tris-HCl pH 8.0, 150 mM NaCl>95% purity
StorageFlash-freeze aliquots20 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerolPreserve activity

The purification protocol should be performed at 4°C to maintain enzyme stability, and the addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) may help prevent oxidation of cysteine residues. For the Salmonella CobS homolog, researchers successfully used histidine-tagged purification approaches that yielded active enzyme preparations capable of synthesizing adenosylcobalamin-5'-phosphate in vitro .

How can one assess the purity and integrity of purified recombinant CobS?

The purity and integrity of recombinant CobS can be assessed using multiple complementary techniques:

  • SDS-PAGE analysis: Should show a single prominent band at the expected molecular weight

  • Western blot: Using anti-His antibodies (for His-tagged protein) or specific antibodies against CobS

  • Mass spectrometry: For accurate molecular weight determination and peptide mass fingerprinting

  • Size exclusion chromatography: To assess oligomeric state and aggregation

  • UV-visible spectroscopy: To evaluate protein concentration and presence of bound cofactors

  • Circular dichroism (CD): To confirm proper protein folding and secondary structure content

  • Dynamic light scattering (DLS): To assess homogeneity and potential aggregation

The functional integrity should be confirmed through activity assays, such as the cobalamin synthase assay described in the research on S. typhimurium CobS, which measured the conversion of adenosylcobinamide-GDP and α-ribazole-5'-phosphate to adenosylcobalamin-5'-phosphate .

What are the established methods for assaying CobS enzymatic activity?

Based on the research conducted with Salmonella CobS, several methods can be adapted for assaying P. syringae CobS activity:

  • HPLC-based assay: The most direct method involves incubating CobS with its substrates (adenosylcobinamide-GDP and α-ribazole-5'-phosphate), followed by reverse-phase HPLC (RP-HPLC) separation and UV-visible detection of the adenosylcobalamin-5'-phosphate product .

  • Radiolabeled substrate assay: Using radiolabeled substrates to track the formation of products, this method provides quantitative measurements of enzyme activity. Researchers reported specific activities of 8-22 nmol of product per min per mg of protein for extracts containing CobS .

  • Growth complementation assay: A biological assay where the product of the CobS reaction is tested for its ability to support the growth of cobalamin auxotrophs (e.g., S. typhimurium strain JE212). This confirms that the product has biological activity .

  • Mass spectrometry: LC-MS/MS can be used to identify and quantify the products of the CobS reaction, providing both structural confirmation and quantitative analysis.

Each of these methods provides different but complementary information about CobS activity, with the HPLC approach being perhaps the most widely applicable for routine assays.

What are the optimal conditions for CobS enzymatic activity in vitro?

The optimal conditions for CobS enzymatic activity likely include:

ParameterOptimal ConditionNotes
pH7.5-8.0Tris-HCl buffer commonly used
Temperature30-37°CBacterial enzyme optimal range
Metal ionsMg2+ requiredTypically 5-10 mM MgCl2
ATPRequiredFor energy coupling
Reducing environmentDTT or β-METo maintain reduced state of enzyme
SubstratesAdoCbi-GDP, α-ribazole-5'-PSpecific concentrations determined experimentally

While specific optimal conditions for P. syringae CobS are not explicitly provided in the search results, the successful in vitro reactions with the Salmonella enzyme provide a starting point for establishing these conditions. The reaction was successfully performed in a system containing AdoCbi, GTP, DMB, and NaMN along with the necessary enzymes, suggesting these components create a suitable environment for CobS activity .

How can substrate specificity of CobS be determined experimentally?

To determine the substrate specificity of CobS experimentally, researchers can employ several approaches:

  • Substrate analog testing: Synthesize or obtain structural analogs of the natural substrates (adenosylcobinamide-GDP and α-ribazole-5'-phosphate) with systematic modifications, then measure enzyme activity with each analog. This approach can reveal which chemical features are critical for recognition and catalysis.

  • Kinetic analysis: Determine Michaelis-Menten parameters (Km, kcat, kcat/Km) for various substrates to quantitatively assess substrate preference. The research on Salmonella CobS suggested that "kinetic analysis of the CobS reaction with α-ribazole or α-ribazole-5′-P and CobC with α-ribazole-5′-P or AdoCbl-5′-P as substrates is needed to define the timing of phosphate removal in vivo more accurately" .

  • Competition assays: Measure enzyme activity with the natural substrate in the presence of increasing concentrations of potential alternative substrates to assess competitive inhibition.

  • Structural biology approaches: X-ray crystallography or cryo-EM of CobS in complex with various substrates or substrate analogs can provide direct visualization of substrate binding and specificity determinants.

  • Directed evolution and mutational analysis: Create variants of CobS and test their activity with different substrates to identify residues critical for substrate specificity.

The research on Salmonella CobS demonstrated that the enzyme could use α-ribazole-5'-phosphate as a substrate in the absence of CobC, suggesting some flexibility in substrate recognition that could be further explored with these methods .

What is known about the tertiary structure of P. syringae CobS and how does it relate to function?

While the search results don't provide specific information about the tertiary structure of P. syringae CobS, some inferences can be made based on the function and related enzymes. CobS likely possesses:

  • Substrate binding domains: Specific pockets for adenosylcobinamide-GDP and α-ribazole-5'-phosphate

  • Catalytic domain: Containing residues that facilitate the formation of the glycosidic bond

  • Metal ion coordination site: Likely requiring Mg2+ or other divalent cations for activity

The tertiary structure would need to accommodate the large and complex corrin ring structure of adenosylcobinamide-GDP while precisely positioning the α-ribazole-5'-phosphate for the attachment reaction. The enzyme's structure must also protect the reactive intermediates from the aqueous environment during catalysis.

Determining the actual structure would require X-ray crystallography, cryo-EM, or NMR spectroscopy studies specifically of P. syringae CobS, which appear to be lacking in the current literature based on the search results.

What active site residues are critical for CobS catalytic activity?

  • Basic residues (Arg, Lys, His): To interact with the phosphate groups of the substrates

  • Acidic residues (Asp, Glu): Potentially involved in metal ion coordination or as catalytic bases

  • Polar residues (Ser, Thr, Asn, Gln): For hydrogen bonding with substrate functional groups

  • Aromatic residues (Phe, Tyr, Trp): Possibly involved in stacking interactions with the dimethylbenzimidazole moiety

To definitively identify these residues, site-directed mutagenesis studies coupled with activity assays would be required. Comparative sequence analysis with other characterized CobS proteins could also help identify conserved residues likely to be functionally important.

How do mutations in specific domains affect CobS activity and substrate binding?

The effects of mutations in CobS domains would need to be experimentally determined through site-directed mutagenesis studies followed by biochemical characterization. While the search results don't provide specific information on mutational studies of P. syringae CobS, a systematic approach would involve:

  • Conservation analysis: Identifying highly conserved residues across CobS homologs from different species

  • In silico prediction: Using computational approaches to predict critical residues for substrate binding and catalysis

  • Alanine scanning: Systematically replacing putative functional residues with alanine to assess their importance

  • Functional substitutions: Replacing residues with others having similar or dissimilar properties to fine-tune understanding of their roles

Expected effects of mutations could include:

  • Altered substrate binding affinity (changes in Km)

  • Reduced catalytic rate (decreased kcat)

  • Complete loss of activity for mutations of essential catalytic residues

  • Altered substrate specificity for mutations in the substrate binding pockets

  • Changes in protein stability or folding

The experimental design for such studies would require expression and purification of mutant enzymes followed by detailed kinetic analysis and potentially structural studies to interpret the results fully.

How can recombinant CobS be used in engineered cobalamin biosynthetic pathways?

Recombinant CobS can serve several purposes in engineered cobalamin biosynthetic pathways:

  • Pathway completion: Introducing CobS into organisms that lack complete B12 biosynthesis pathways to enable de novo vitamin B12 production

  • Increasing production yields: Overexpressing CobS in natural B12 producers to overcome bottlenecks in the pathway

  • Synthesis of cobalamin analogs: Engineering CobS with altered specificity to incorporate non-standard bases into the nucleotide loop, producing cobalamin analogs with potentially novel properties

  • Pathway reconstitution: Combining CobS with other cobalamin biosynthetic enzymes to reconstitute partial or complete pathways in heterologous hosts

  • Metabolic engineering: Integrating cobalamin production with other metabolic pathways that require B12 as a cofactor

The research indicates that bacteria can produce "around 15 different variants of cobalamin" collectively called cobamides or corrinoids, which differ mainly in the nature of the base incorporated into the lower nucleotide loop . This diversity suggests that engineering CobS could potentially allow for the production of novel cobamides with specialized properties.

What are the challenges in expressing functional recombinant CobS in heterologous hosts?

Expressing functional recombinant CobS in heterologous hosts may present several challenges:

  • Protein folding and solubility: Ensuring proper folding of CobS in the expression host, as misfolding could lead to inclusion body formation or degradation

  • Cofactor availability: If CobS requires specific cofactors or metal ions, these must be available in the expression host

  • Post-translational modifications: Any required modifications must be properly executed in the heterologous system

  • Substrate availability: The expression host must either produce or be supplemented with the substrates for CobS activity

  • Toxic effects: Overexpression might burden cellular resources or accumulated intermediates might be toxic

  • Compatibility with host physiology: pH, redox state, and other physiological parameters must be suitable for CobS activity

For the expression of recombinant proteins from P. syringae, researchers have successfully used E. coli expression systems with appropriate vectors and tags, as demonstrated by the expression of RecT and RecE homologs from P. syringae . Similar approaches could likely be adapted for CobS expression.

How can CRISPR-Cas and recombineering be used to modify cobS in Pseudomonas syringae?

Modifying the cobS gene in P. syringae can be accomplished using targeted genetic engineering techniques:

  • Recombineering approach with RecTE system: The RecT and RecE homologs identified in P. syringae pv. syringae B728a can be used for efficient recombination of exogenous DNA with the bacterial chromosome. Research has shown that "the Pseudomonas RecT homolog is sufficient to promote recombination of single-stranded DNA oligonucleotides and that efficient recombination of double-stranded DNA requires the expression of both the RecT and RecE homologs" . This system can be employed to introduce specific mutations into cobS.

  • CRISPR-Cas9 genome editing: While not specifically mentioned for cobS in the search results, CRISPR-Cas9 can be adapted for use in P. syringae by:

    • Designing guide RNAs targeting cobS

    • Introducing the Cas9 enzyme and guide RNA via suitable vectors

    • Providing a repair template containing the desired modifications

    • Selecting for successfully edited cells

  • Combined approach: The most efficient strategy might combine recombineering with CRISPR-Cas9, where RecTE promotes homologous recombination while CRISPR-Cas9 creates targeted double-strand breaks and selects against unmodified cells.

For example, to introduce specific mutations in the active site of CobS, researchers could design oligonucleotides with the desired changes flanked by homology regions and use the RecT system to promote their incorporation into the genome .

How does CobS activity influence the production of different cobamide variants?

CobS activity directly influences the production of different cobamide variants through its role in attaching the lower nucleotide loop to the corrin ring structure. The search results indicate that:

  • Base variation: Different bacteria produce about 15 different variants of cobalamin (collectively called cobamides or corrinoids) that differ primarily in the nature of the base incorporated into the lower nucleotide loop . For example, some bacteria incorporate adenine instead of dimethylbenzimidazole, producing pseudocobalamin .

  • Substrate specificity: The specificity of CobS for different α-ribazole-5'-phosphate-like molecules (containing different bases) would determine which cobamide variant is produced. If CobS can accept substrates with alternative bases, it could participate in the synthesis of various cobamides.

  • Pathway regulation: The activity of CobS, along with other enzymes in the pathway, is likely regulated to control which cobamide variants are produced under different conditions.

Understanding and potentially engineering CobS specificity could enable the controlled production of specific cobamide variants, which could be valuable for both research and potential applications, as different cobamides may have different properties in cobamide-dependent enzymes.

What is the relationship between cobalt incorporation and CobS function in the cobalamin biosynthetic pathway?

Cobalt incorporation and CobS function represent distinct but interconnected aspects of the cobalamin biosynthetic pathway:

This relationship highlights the complex and highly coordinated nature of cobalamin biosynthesis, with CobS playing a specific role in the late stages of the pathway after cobalt has already been incorporated into the molecule.

How can transcriptomic analysis inform our understanding of cobS expression and regulation in P. syringae?

Transcriptomic analysis can provide valuable insights into cobS expression and regulation in P. syringae through several approaches:

Advanced techniques like Illumina sequencing, which was used to obtain "478 million bases of high-quality, strand-specific transcript data" from P. syringae pv. tomato DC3000 , can provide the detailed information needed for these analyses.

How can site-directed mutagenesis be used to improve CobS stability or activity?

Site-directed mutagenesis can be strategically employed to enhance CobS stability and activity through several approaches:

  • Stability enhancement strategies:

    • Introduction of disulfide bridges at appropriate positions to stabilize tertiary structure

    • Substitution of surface residues to optimize surface charge distribution and reduce aggregation propensity

    • Replacement of oxidation-prone residues (Met, Cys) with more stable alternatives

    • Introduction of proline residues in loop regions to reduce flexibility and enhance thermostability

    • Filling of hydrophobic cavities to improve packing and stability

  • Activity enhancement approaches:

    • Mutation of active site residues to optimize substrate binding and catalysis

    • Engineering of substrate access channels to improve substrate flux

    • Modification of residues involved in rate-limiting steps

    • Alteration of allosteric sites to reduce inhibition or enhance activation

  • Rational design methodology:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to identify flexible regions and stability determinants

    • Computational prediction of stabilizing mutations using tools like FoldX or Rosetta

    • Multiple sequence alignment to identify conserved residues and potential targets for non-conserved positions

  • Experimental validation:

    • Thermal shift assays to assess thermostability changes

    • Long-term storage stability tests

    • Kinetic analysis to quantify changes in catalytic parameters

    • Structural analysis of successful variants to understand the molecular basis of improvements

While the search results do not specifically describe site-directed mutagenesis of CobS, the recombineering techniques developed for P. syringae using RecT and RecE homologs provide a potential methodology for introducing these mutations into the native organism .

What techniques can be used to study the interaction between CobS and other enzymes in the cobalamin biosynthetic pathway?

Multiple complementary techniques can be employed to study the interactions between CobS and other enzymes in the cobalamin biosynthetic pathway:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation (Co-IP) to pull down protein complexes from cell lysates

    • Bacterial two-hybrid systems to detect interactions in vivo

    • Surface plasmon resonance (SPR) to measure binding kinetics and affinities

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

    • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) for detecting interactions in living cells

  • Structural biology approaches:

    • X-ray crystallography of multi-enzyme complexes

    • Cryo-electron microscopy to visualize larger assemblies

    • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map binding regions

  • Functional analysis:

    • Enzyme activity assays with purified components to detect synergistic effects

    • Metabolic flux analysis to track pathway intermediates

    • Reconstitution of partial or complete pathways in vitro

    • Genetic approaches like synthetic lethal screens or suppressor analyses

  • Systems biology methods:

    • Transcriptomic analysis to identify co-regulated genes

    • Proteomic approaches to detect protein complexes

    • Metabolomic profiling to track pathway intermediates

For example, research on the Salmonella cobalamin biosynthetic pathway demonstrated functional interactions between CobU, CobT, CobS, and CobC through in vitro reconstitution of the pathway, showing that these enzymes work in concert to convert adenosylcobinamide to adenosylcobalamin .

How can computational approaches aid in understanding CobS mechanism and evolution?

Computational approaches offer powerful tools for investigating CobS mechanism and evolution:

These computational approaches can complement experimental methods and provide insights that might be difficult to obtain through experiments alone. For instance, the search results mention that researchers used PSI-BLAST searches to identify RecT and RecE homologs in P. syringae , demonstrating the value of computational sequence analysis in identifying functionally related proteins.

What are common issues in recombinant CobS expression and how can they be addressed?

Researchers may encounter several challenges when expressing recombinant CobS, along with potential solutions:

IssuePossible CausesSolutions
Low expression levelsWeak promoter, rare codons, mRNA instabilityOptimize codon usage, use stronger promoters, optimize ribosome binding site, reduce growth temperature
Inclusion body formationRapid expression, improper foldingLower induction temperature (16-20°C), reduce inducer concentration, co-express chaperones, use solubility tags (MBP, SUMO)
Protein instabilityProteolytic degradation, oxidationAdd protease inhibitors, include reducing agents, use protease-deficient host strains
Loss of activityCofactor loss, improper folding, oxidationInclude cofactors in buffers, optimize purification conditions, maintain reducing environment
Low solubilityHydrophobic patches, improper foldingAdd solubilizing agents, optimize buffer conditions, use solubility tags
Aggregation during purificationHydrophobic interactions, disulfide formationInclude mild detergents, maintain reducing conditions, optimize salt concentration

Based on strategies used for similar proteins, researchers can implement specific approaches such as:

  • Expression optimization: The search results describe the creation of expression vectors with the P. syringae recT and recTE genes, which could serve as a model for CobS expression. These included the use of constitutive promoters and Gateway cloning systems .

  • Purification strategies: For the Salmonella CobS homolog, researchers successfully used histidine-tagged purification approaches that yielded active enzyme preparations .

  • Activity preservation: The search results indicate that the purified (His)6CobS preparation from Salmonella was functionally active in synthesizing adenosylcobalamin-5'-phosphate, suggesting that proper purification conditions can maintain enzyme activity .

How can one troubleshoot inconsistent results in CobS activity assays?

When facing inconsistent results in CobS activity assays, a systematic troubleshooting approach should be employed:

  • Enzyme quality assessment:

    • Verify protein purity by SDS-PAGE and potentially mass spectrometry

    • Check for protein degradation through Western blotting

    • Assess protein folding status via circular dichroism

    • Measure protein concentration accurately using multiple methods

  • Substrate and cofactor verification:

    • Confirm the purity and integrity of adenosylcobinamide-GDP and α-ribazole-5'-phosphate

    • Ensure adequate concentration and quality of required cofactors (e.g., Mg2+)

    • Prepare fresh substrate stocks to avoid degradation issues

  • Reaction conditions optimization:

    • Control temperature precisely during reactions

    • Verify and adjust pH of reaction buffers

    • Test different buffer compositions to identify optimal conditions

    • Control oxygen exposure if the enzyme or substrates are oxygen-sensitive

  • Detection method validation:

    • Calibrate HPLC or other analytical instruments regularly

    • Generate standard curves with pure compounds

    • Use internal standards to normalize between runs

    • Compare results across multiple detection methods

  • Experimental controls:

    • Include positive controls (known active enzyme preparations)

    • Run negative controls (heat-inactivated enzyme)

    • Perform spike recovery experiments to test for inhibitory compounds

The research on Salmonella CobS used multiple complementary methods to assess activity, including HPLC analysis, radiolabeled substrate assays, and biological complementation tests . This multi-method approach can help validate results and identify sources of variability.

What considerations are important when scaling up CobS production for research purposes?

Scaling up CobS production for research purposes requires careful consideration of several factors:

  • Expression system optimization:

    • Select an appropriate host strain with good growth characteristics and high protein expression capability

    • Optimize media composition for cost-effectiveness and yield

    • Develop fed-batch or continuous culture strategies to maximize biomass and protein production

    • Balance expression level with protein solubility to avoid inclusion body formation

  • Fermentation parameters:

    • Monitor and control dissolved oxygen levels

    • Maintain optimal pH through automatic control systems

    • Implement appropriate temperature control strategies, especially during induction

    • Consider the timing and concentration of inducer addition

  • Purification scale-up considerations:

    • Select chromatography media with appropriate binding capacity and flow properties

    • Optimize buffer volumes and compositions for larger scale preparations

    • Develop efficient concentration and diafiltration strategies

    • Implement quality control checkpoints throughout the process

  • Stability and storage optimization:

    • Determine optimal storage conditions (temperature, buffer composition)

    • Assess long-term stability under different conditions

    • Consider lyophilization or other stabilization methods if appropriate

    • Develop quality control assays to monitor activity over time

  • Documentation and reproducibility:

    • Establish detailed standard operating procedures

    • Implement robust record-keeping practices

    • Develop in-process controls to ensure batch-to-batch consistency

While the search results don't specifically address CobS production scale-up, the expression and purification strategies developed for other recombinant proteins from P. syringae, such as the RecT and RecE homologs, could provide useful starting points for developing a scaled-up CobS production process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.