Recombinant Pseudomonas syringae pv. syringae Disulfide bond formation protein B 1 (dsbB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pseudomonas syringae pv. syringae Disulfide Bond Formation Protein B1 (dsbB1) is a periplasmic oxidoreductase critical for catalyzing disulfide bond formation in substrate proteins, enabling proper folding and functional maturation. This protein (UniProt ID: Q4ZXC8) is essential for the virulence of P. syringae, a plant pathogen that relies on redox-regulated pathways to deploy effector proteins during infection .

Functional Role in Bacterial Pathogenesis

DsbB1 is indispensable for virulence in P. syringae. Key findings from research include:

3.1. Impact on Virulence Pathways

  • Type III Secretion System (T3SS): Disruption of dsbB1 homologs (e.g., dsbA) reduces secretion of T3SS effectors like HrpZ and AvrRpt2, impairing bacterial motility and host colonization .

  • Effector Protein Maturation: DsbB1 ensures proper folding of virulence factors, including the cytotoxic effector HopBJ1, which induces ROS-mediated cell death in plants .

3.2. Phenotypic Consequences of dsbB1 Knockouts

PhenotypeObservation
Mucoid Colony MorphologyIncreased alginate production due to redox imbalance .
Reduced MotilityImpaired flagellar assembly and function .
Growth RateSlower in vitro growth under oxidative stress .

4.1. Expression and Purification

  • Cloning: The dsbB1 gene (locus tag: Psyr_1140) is cloned into E. coli vectors under T7/lac promoters .

  • Reconstitution: Requires solubilization in Tris/PBS buffer with 6% trehalose and glycerol (up to 50%) for long-term stability .

4.2. Research Applications

  • Enzymatic Assays: Used to study disulfide bond formation kinetics and redox partner interactions .

  • Pathogenesis Studies: Serves as a tool to dissect redox regulation in P. syringae effector deployment .

Genomic and Evolutionary Insights

  • Synteny Conservation: dsbB1 resides in a genomic region adjacent to T3SS structural genes (hrc/hrp), suggesting co-regulation with virulence loci .

  • Horizontal Gene Transfer: Phylogenetic analyses indicate dsbB1 homologs are widespread in Pseudomonas spp., with evidence of recombination events shaping redox adaptation .

Implications for Plant Disease Management

DsbB1 is a potential target for antimicrobial strategies. Inhibitors of its oxidoreductase activity could disrupt effector protein maturation, reducing bacterial fitness in planta. Studies on dsbB1 mutants demonstrate attenuated virulence in Arabidopsis thaliana and Nicotiana benthamiana, highlighting its therapeutic promise .

Outstanding Research Questions

  1. Does dsbB1 interact directly with T3SS chaperones like ShcV or HpaB to regulate effector export?

  2. How do environmental stressors (e.g., host ROS bursts) modulate dsbB1 activity?

  3. Are there natural plant compounds that inhibit dsbB1 without harming host redox systems?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB1; Psyr_1140; Disulfide bond formation protein B 1; Disulfide oxidoreductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
dsbB1
Target Protein Sequence
MSDNTLYLRREKRFLVLLGIICLALIGGALYMQVVLDEAPCPLCILQRYALLFIAIFAFI GAAMPGRRSVTAFETLVTLSALGGIAAAGRHVWILAHPSDSCGIDVLQPIVDGLPLATLF PTGFQVSGFCTTPYPPVLGLSLAQWALTAFVLTAVLVPACIIRNRRKPY
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is disulfide bond formation protein B 1 (dsbB1) in Pseudomonas syringae pv. syringae?

Disulfide bond formation protein B 1 (dsbB1) in Pseudomonas syringae pv. syringae is a membrane protein that functions in the oxidative pathway responsible for the formation of disulfide bonds in periplasmic proteins. Similar to its homolog in E. coli, dsbB1 is believed to be involved in re-oxidizing DsbA, which directly catalyzes disulfide bond formation in substrate proteins. The protein contains conserved cysteine residues that form exchangeable disulfide bonds, typically in a -Cys-Val-Leu-Cys- motif . Phylogenomic analyses place P. syringae in clade I of the pseudomonad taxonomic grouping, providing context for understanding the evolutionary relationships of dsbB1 across bacterial species . This protein plays a crucial role in the maturation of virulence factors and is therefore essential for bacterial pathogenicity.

How does dsbB1 in P. syringae compare to the well-characterized DsbB in E. coli?

While both proteins perform similar functions in their respective organisms, there are several key differences between dsbB1 in P. syringae and DsbB in E. coli:

FeatureP. syringae dsbB1E. coli DsbB
Molecular weight~20 kDa (predicted)20 kDa
Transmembrane domainsMultiple (predicted)Four
Active siteContains conserved cysteine residuesContains two pairs of essential cysteines
Redox partnerInteracts with P. syringae DsbAInteracts with E. coli DsbA
Gene regulationLess characterizedTranscription from two promoters, neither resembling canonical Eσ70-recognized promoter

The interactions between DsbB and DsbA in E. coli have been extensively characterized, with studies showing that DsbA is a potent oxidant with an unusually unstable disulfide bond that actually destabilizes the protein's folded conformation by approximately 3.6 kcal·mol⁻¹ . Similar detailed studies on P. syringae dsbB1-DsbA interactions are still emerging, but the fundamental mechanism is believed to be conserved across species while potentially exhibiting organism-specific adaptations.

What genetic tools are available for studying dsbB1 in P. syringae?

Several genetic approaches can be employed to study dsbB1 in P. syringae:

  • Recombineering using RecTE: This technique from P. syringae enables genomic recombination of linear DNA introduced into cells by electroporation. The RecT homolog is sufficient for recombination of single-stranded DNA oligonucleotides, while efficient recombination of double-stranded DNA requires expression of both RecT and RecE homologs . This method is particularly useful for creating targeted gene disruptions or modifications of dsbB1.

  • Expression vector systems: Plasmids such as pMCh-23 that have been successfully used to express proteins (like RFP) in Pseudomonas can be adapted for recombinant expression of dsbB1 .

  • Comparative genomics and transcriptomics: These approaches allow for detailed investigation of genetic mechanisms related to dsbB1 function and regulation in pathogenicity .

  • Randomized block designs for experimental planning: Such statistical approaches help design experiments with proper controls and sufficient replication to study dsbB1 function in vivo .

What is the optimal experimental design for expressing and purifying recombinant dsbB1?

Optimal experimental design for expression and purification of recombinant dsbB1 from P. syringae should address the following methodological considerations:

Expression System Selection:

  • E. coli-based expression: While convenient, may require codon optimization due to different codon usage between Pseudomonas and E. coli.

  • Homologous expression in Pseudomonas: Provides proper post-translational modifications but typically yields lower protein amounts.

  • Cell-free expression systems: Useful for membrane proteins like dsbB1 that may be toxic when overexpressed.

Purification Strategy:
As a membrane protein, dsbB1 requires specific approaches:

StepMethodRationale
Cell lysisMechanical disruption or detergent-based lysisGentle methods preserve protein structure
Membrane extractionDifferential centrifugationSeparates membrane fractions
SolubilizationDetergent screening (DDM, LDAO, etc.)Identifies optimal detergent for solubilization
PurificationIMAC, ion exchange, size exclusionMultiple steps ensure high purity
Quality controlSDS-PAGE, mass spectrometry, activity assaysVerifies integrity and function

When designing experiments to study dsbB1, researchers should employ randomized complete block designs (RCB) to account for experimental variables. This approach helps control variability by blocking potential confounding factors such as different expression batches or purification runs . The appropriate number of replicates should be determined based on statistical power analysis to ensure reliable detection of treatment effects.

How can recombineering techniques be optimized for studying dsbB1 function?

Recombineering offers powerful tools for precise genetic manipulation of dsbB1 in P. syringae. Optimized approaches include:

  • Selection of appropriate recombineering proteins: The RecT homolog from P. syringae is sufficient for recombination with single-stranded DNA oligonucleotides, while both RecT and RecE homologs are required for efficient recombination with double-stranded DNA . Expression levels of these proteins should be carefully controlled to maximize recombination efficiency while minimizing cellular toxicity.

  • Oligonucleotide design considerations:

    • Length: 60-80 nucleotides typically provides optimal balance between specificity and recombination efficiency

    • Modifications: 5'-phosphorothioate modifications can protect against exonuclease degradation

    • Strand bias: Target the lagging strand of DNA replication for higher efficiency

  • Targeting strategy for functional analysis:

    • Single amino acid substitutions of conserved cysteines to investigate catalytic mechanism

    • Domain swapping with E. coli DsbB to identify species-specific functional regions

    • Promoter modifications to study regulation

    • Introduction of epitope tags for protein interaction studies

  • Validation approaches:

    • Quantitative assays based on recombination frequency should be employed

    • Phenotypic screens for loss of pathogenicity

    • Biochemical assays for disulfide bond formation activity

The application of recombineering techniques enables targeted gene disruptions in the P. syringae chromosome, allowing for precise functional characterization of dsbB1 in its native context .

What is the relationship between dsbB1 function and bacterial virulence in P. syringae?

The relationship between dsbB1 function and bacterial virulence in P. syringae involves several interconnected mechanisms:

  • Virulence factor maturation: Many secreted virulence factors require proper disulfide bond formation for stability and activity. Disruption of dsbB1 likely impairs the folding and function of these factors.

  • Type III secretion system (T3SS): Components of the T3SS machinery may depend on disulfide bonds for proper assembly and function. The T3SS is critical for delivering effector proteins into plant cells during infection.

  • Stress resistance: Proper disulfide bond formation contributes to bacterial resistance against oxidative stress encountered during plant infection.

Experimental approaches to investigate this relationship include:

  • Comparative genomics and transcriptomics: These techniques allow detailed investigation of genetic mechanisms underlying pathogenicity, including the role of dsbB1 .

  • Mutant phenotype analysis: Construction of dsbB1 deletion or point mutants using recombineering techniques allows for assessment of virulence phenotypes on host plants .

  • Proteomic analysis: Identification of proteins affected by dsbB1 mutation provides insights into the disulfide-dependent virulence factors.

Similar to observations in E. coli, where null mutations in dsbB confer pleiotropic phenotypes such as sensitivity to benzylpenicillin and inability to support filamentous phage formation , mutations in P. syringae dsbB1 are expected to produce multiple phenotypic effects related to virulence.

How do environmental conditions affect dsbB1 function in P. syringae?

Environmental conditions significantly influence dsbB1 function and consequently affect P. syringae pathogenicity. Key factors include:

1. Temperature effects:

  • Temperature fluctuations encountered by P. syringae during plant colonization likely influence dsbB1 activity

  • Similar to observations in other bacteria, lower temperatures may reduce the rate of disulfide bond formation

  • Experimental approaches should employ temperature-controlled environments with factorial designs to assess interaction effects

2. pH dependence:

  • The plant apoplast pH changes during infection, potentially affecting dsbB1 function

  • Optimal pH for dsbB1 activity may differ from that of E. coli DsbB (which functions in the relatively neutral periplasm)

3. Oxidative environment:

  • Plant defense responses generate reactive oxygen species that may interfere with or enhance dsbB1 activity

  • The DsbB pathway in E. coli couples disulfide bond formation to the respiratory chain , suggesting similar mechanisms may exist in P. syringae

4. Nutrient availability:

  • Nutrient limitation during plant colonization may alter expression of dsbB1

  • Carbon source availability might influence dsbB1 expression through global regulatory networks

To properly study these environmental effects, nested sampling experimental designs are recommended, as they allow for estimation of variance components at different hierarchical levels (e.g., between experimental conditions, between biological replicates, within technical replicates) . This approach helps distinguish true environmental effects from experimental variability.

What protein-protein interactions are critical for dsbB1 function?

The function of dsbB1 in P. syringae depends on specific protein-protein interactions that facilitate the electron transfer necessary for disulfide bond formation. Key interactions include:

  • dsbB1-DsbA interaction: Similar to E. coli, where DsbB oxidizes the reduced form of DsbA, dsbB1 in P. syringae likely interacts directly with its corresponding DsbA protein. In E. coli, this interaction involves the formation of mixed disulfides between specific cysteine residues in both proteins . The crystal structure of E. coli DsbA reveals that its active site is located at a domain interface surrounded by grooves and exposed hydrophobic side chains, which might facilitate interactions with DsbB and substrate proteins .

  • dsbB1-quinone interaction: In E. coli, DsbB transfers electrons from DsbA to membrane-bound quinones of the respiratory chain . Similar mechanisms likely exist in P. syringae, though the specific quinones involved may differ.

  • Potential dsbB1-substrate interactions: Some evidence from E. coli suggests that DsbB might interact directly with certain substrate proteins, bypassing DsbA in specific cases.

Methodological approaches to study these interactions include:

  • Co-immunoprecipitation: Allows identification of protein complexes containing dsbB1

  • Bacterial two-hybrid systems: Enables detection of direct protein-protein interactions

  • Site-directed mutagenesis: Identifies critical residues involved in protein-protein interactions

  • Cross-linking studies: Captures transient interactions that might be difficult to detect by other methods

How can structural biology techniques be applied to study dsbB1?

Structural characterization of dsbB1 presents significant challenges due to its membrane-embedded nature, but several approaches can be employed:

  • X-ray crystallography:

    • Requires detergent-solubilized, purified protein

    • Crystallization may be facilitated by the use of antibody fragments or fusion partners

    • Similar approaches have been successful for E. coli DsbA, revealing a thioredoxin-like fold with an additional domain forming a cap over the active site

  • Cryo-electron microscopy:

    • Particularly useful for membrane proteins like dsbB1

    • May allow visualization of dsbB1 in its native membrane environment

    • Can potentially capture different conformational states

  • NMR spectroscopy:

    • Suitable for studying dynamics and interactions

    • May require isotopic labeling for optimal results

    • Can be challenging for membrane proteins but has been successfully applied to similar systems

  • Computational modeling:

    • Homology modeling based on E. coli DsbB structure

    • Molecular dynamics simulations to study conformational changes

    • Docking studies to predict protein-protein interactions

When designing structural biology experiments, factorial designs with two or more factors should be considered to efficiently explore various conditions affecting protein stability and crystallization . For instance, a factorial design could test combinations of different detergents, pH values, and additives to identify optimal conditions for structural studies.

How do dsbB homologs differ across Pseudomonas species?

Comparative analysis of dsbB homologs across Pseudomonas species reveals important evolutionary and functional insights:

  • Phylogenetic distribution: Core genome-based approximate maximum likelihood phylogenomic analyses have organized Pseudomonas species into four main clades: P. syringae species complex (clade I), P. fluorescens species complex (clade II), P. simiae species complex (clade III), and Pseudomonas A species complex (clade IV) . The distribution and conservation of dsbB homologs across these clades provide insights into the evolutionary history and functional importance of these proteins.

  • Sequence conservation: Key functional motifs, particularly the cysteine-containing active sites, show high conservation across species, while other regions display greater variability. This pattern suggests strong selective pressure to maintain catalytic function while allowing adaptation to different ecological niches.

  • Genomic context: The genomic organization around dsbB genes varies between Pseudomonas species, potentially reflecting differences in regulation and functional integration with other cellular processes.

  • Number of paralogs: Some Pseudomonas species contain multiple dsbB paralogs, suggesting functional specialization. For example, distinct paralogs might be involved in general protein folding versus specific virulence factor maturation.

Methodological approaches for studying these differences include:

  • Whole genome sequencing-based phylogenomic analysis: This approach improves identification of isolates through elucidation of functional profiles of taxonomic groups and can resolve ambiguities in the phylogeny of higher taxa that would be difficult using traditional approaches .

  • Taxonomic assignment methods: Techniques such as digital DNA-DNA hybridization (dDDH) and average nucleotide identity based on BLAST (ANIb) provide congruent results in assigning species to taxonomic groups .

What experimental design strategies are most effective for studying dsbB1 function in planta?

Studying dsbB1 function during actual plant infection requires carefully designed experiments that account for biological variability and environmental factors:

  • Randomized Complete Block Design (RCB):

    • Effectively controls for environmental variation in greenhouse or growth chamber studies

    • Allows for blocking based on plant age, position, or other variables

    • Appropriate for testing multiple bacterial strains (e.g., wild-type vs. dsbB1 mutants)

  • Split-plot designs:

    • Useful when some experimental factors are difficult to randomize

    • Could be used when combining different plant genotypes with various bacterial strains

  • Factorial designs:

    • Allow simultaneous testing of multiple factors and their interactions

    • Can examine how dsbB1 function responds to different environmental conditions during infection

    • Particularly valuable for understanding complex interactions between pathogen and host

  • Time-course studies:

    • Critical for understanding the dynamics of infection

    • Require appropriate statistical methods for repeated measures

When determining sample sizes, researchers should conduct power analysis to ensure sufficient statistical power to detect biologically meaningful effects. Additionally, proper randomization procedures are essential to minimize bias . Sophisticated methods like staggered nested designs might be appropriate for complex experiments involving multiple factors at different hierarchical levels .

What innovative approaches could advance our understanding of dsbB1 function?

Several cutting-edge approaches show promise for deepening our understanding of dsbB1 function:

  • CRISPR-Cas9 genome editing: While recombineering using RecTE has proven effective for genetic manipulation in P. syringae , CRISPR-Cas9 systems adapted for Pseudomonas could provide even more precise and efficient genome editing capabilities for studying dsbB1.

  • Single-cell analyses: Techniques such as single-cell RNA-seq could reveal population heterogeneity in dsbB1 expression during infection, potentially identifying subpopulations with distinct virulence characteristics.

  • Synthetic biology approaches: Engineering synthetic variants of dsbB1 with novel or enhanced functions could provide insights into structure-function relationships and potentially lead to new biotechnological applications.

  • Systems biology integration: Combining transcriptomics, proteomics, and metabolomics data could provide a holistic view of how dsbB1 functions within the broader context of bacterial physiology and pathogenesis.

  • Cryo-electron tomography: This technique could visualize the native organization of dsbB1 within the bacterial membrane in near-native conditions, providing insights into its spatial organization and potential interactions with other membrane components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.