Recombinant Pseudomonas syringae pv. syringae Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
msbA; Psyr_0536; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
msbA
Target Protein Sequence
MTTSESSATSSVKIYFRLLSYVRPYVGIFLLSIIGFVIFASTQPMLAGILKYFVDGLTNP EAVLFPNVPYLRELQLLQAVPLLIVLIAAWQGLGSFLGNYFLAKVSLGLVHDLRVELFNK LLVLPNRYFDTTNSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFIYLLMMNWKL TLVMLAILPLIAVMVGTASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEAYEQ ARFAQASNSNTQKQLRMTKTGAIYTPMLQLVIYSAMAVLMFLVLFLRGEATAGDLVAYIT AAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEEEVDTGTIERERVTGHLEVKNLSF FYPQTARQVLNDISFSAAPGQMIALVGRSGSGKSTLANLIPRFYGHDIGNILLDGVEIND YRLRNLRRHIAQVNQNVTLFNDTIANNIAYGDLAGAPRADIEAAAADAYAREFIDQLPQG FDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMKG RTTLVIAHRLSTIEKADLILVMDAGQIVERGTHTELLAQNGYYARLHAMGLDEPAPVGAV
Uniprot No.

Target Background

Function

This protein is involved in lipopolysaccharide (LPS) biosynthesis. Its function includes translocating the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MsbA in Pseudomonas syringae pv. syringae?

MsbA in Pseudomonas syringae pv. syringae functions as an ATP-binding cassette (ABC) transporter that plays a crucial role in lipopolysaccharide (LPS) biogenesis. This protein facilitates the transport of the LPS precursor lipooligosaccharide (LOS) from the cytoplasmic to the periplasmic leaflet of the inner membrane, a critical step in the development of the outer membrane structure in this Gram-negative bacterial pathogen . Unlike what was previously thought to be solely ATP-dependent transport, research has revealed that MsbA also couples substrate transport to a transmembrane electrochemical proton gradient, demonstrating functional integration of both forms of metabolic energy . This dual energy utilization mechanism highlights the sophisticated nature of substrate transport in bacterial systems and its potential impact on pathogenicity.

How does MsbA contribute to the pathogenicity of P. syringae pv. syringae?

MsbA contributes to P. syringae pv. syringae pathogenicity through its essential role in outer membrane biogenesis. By facilitating LPS transport, MsbA helps establish and maintain the asymmetric structure of the outer membrane, with phospholipids comprising the inner leaflet and lipopolysaccharides as the major component of the outer leaflet . This membrane structure provides resistance against antibiotics and various environmental stresses, enabling bacterial survival in hostile environments . In the context of P. syringae as a plant pathogen of over 40 different plant species, the proper functioning of MsbA is fundamental to maintaining membrane integrity during host colonization and pathogenesis . Research examining mutants with defective MsbA function would be essential to further quantify its specific contributions to virulence in plant infection models.

What are the key structural features of the MsbA protein?

The MsbA protein exists in multiple conformational states during its transport cycle. Structural studies have revealed that MsbA can adopt several distinct conformations, including:

  • Open, inward-facing conformations with varying degrees of openness

  • Open, outward-facing conformation

The protein consists of:

  • Membrane domains (MDs) that form the translocation pathway for substrates

  • Nucleotide-binding domains (NBDs) that engage in ATP binding and hydrolysis

Recent high-resolution structural studies have achieved a 2.7 Å-resolution structure of MsbA in an open, outward-facing conformation bound to KDL (Kdo2-lipid A) at the exterior site, with the NBDs adopting a distinct nucleotide-free structure . These structural features provide crucial insights into the molecular mechanisms underlying substrate transport and offer potential targets for experimental manipulation to study functional aspects of the protein.

How is the msbA gene organized within the P. syringae pv. syringae genome?

The msbA gene in P. syringae pv. syringae is part of the core genome rather than a recently acquired element. Comparative genomic analyses of various P. syringae strains, including those from different pathovars and phylogroups, have been conducted to understand the evolutionary relationships and gene organization within this species complex . The gene appears to be conserved across P. syringae sensu lato strains, consistent with its essential cellular function. Detailed genome sequencing studies have enabled researchers to examine the genetic context of msbA and its relationship to other genes involved in LPS biosynthesis and transport . Multilocus sequence analysis (MLSA) and whole genome sequence analysis have been instrumental in distinguishing different phylogroups within P. syringae and understanding the genomic organization across strains .

How does lipid composition modulate MsbA nucleotide binding and transport activity?

Native mass spectrometry (MS) studies have revealed a sophisticated interplay between lipids and nucleotide binding in MsbA function. Research demonstrates that the LPS-precursor 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)2-lipid A (KDL) can tune the selectivity of MsbA for adenosine 5'-triphosphate (ATP) over adenosine 5'-diphosphate (ADP) . This lipid-mediated modulation represents a regulatory mechanism that likely influences transport efficiency.

The relationship between lipid binding and nucleotide preference can be represented by the following comparative data:

ConditionATP AffinityADP AffinityATP/ADP Selectivity Ratio
Without KDLLowerHigher<1
With KDLHigherLower>1

This lipid-dependent nucleotide selectivity suggests that local membrane composition in P. syringae could regulate MsbA activity through allosteric mechanisms . Methodologically, researchers investigating this phenomenon should employ a combination of:

  • Purified protein reconstitution in defined lipid environments

  • Transport assays with varying lipid compositions

  • Binding studies using isothermal titration calorimetry

  • Native MS to directly observe protein-lipid-nucleotide complexes

What are the methodological approaches to study proton-coupled transport by MsbA?

The discovery that MsbA utilizes both ATP and a transmembrane electrochemical proton gradient challenges previous mechanistic models focused solely on ATP as an energy source . To study this proton-coupled transport, researchers should employ the following methodological approaches:

  • Inside-out membrane vesicle preparation:

    • Isolate bacterial membranes containing recombinant MsbA

    • Create sealed vesicles with inverted orientation

    • Establish defined proton gradients using various pH buffers

  • Transport assays with proton gradient manipulation:

    • Use fluorescent lipid analogs or radiolabeled substrates

    • Systematically vary external pH while maintaining internal pH

    • Apply protonophores (e.g., CCCP) to dissipate proton gradients

    • Compare transport rates with and without ATP

  • ATPase activity measurements:

    • Quantify ATP hydrolysis using colorimetric phosphate detection

    • Analyze how proton gradients affect ATPase activity

    • Determine if chemical proton gradients stimulate ATPase function

Research has shown that ATP-dependent transport depends on proton coupling, and the chemical proton gradient stimulates MsbA-ATPase activity . This functional integration of both forms of metabolic energy represents a critical aspect of MsbA function that requires careful experimental design to elucidate fully.

How can researchers distinguish between different conformational states of MsbA during the transport cycle?

MsbA undergoes significant conformational changes during its transport cycle, transitioning between inward-facing and outward-facing states. To capture and analyze these distinct conformations, researchers should implement:

  • Cryo-electron microscopy (cryo-EM):

    • Prepare MsbA samples under various conditions (apo, ATP-bound, ADP-bound, substrate-bound)

    • Use rapid freezing to trap transient conformational states

    • Perform single-particle analysis to resolve structural details

    • Generate 3D reconstructions of different conformational states

  • Double electron-electron resonance (DEER) spectroscopy:

    • Introduce spin labels at strategic positions in the protein

    • Measure distances between spin labels in different conformational states

    • Track conformational changes in response to nucleotide binding/hydrolysis

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose protein to deuterated solvent under various conditions

    • Monitor deuterium incorporation rates in different protein regions

    • Identify regions undergoing conformational changes during the transport cycle

  • Structure-guided mutagenesis:

    • Introduce mutations that stabilize specific conformational states

    • Cross-link residues to lock the protein in defined conformations

    • Assess functional consequences of conformational restriction

Recent structural studies have yielded multiple open, inward-facing structures with varying degrees of openness and a 2.7 Å-resolution structure of the outward-facing conformation bound to KDL . These structures provide valuable reference points for further conformational analysis.

What bioinformatic approaches can be used to identify sequence variations in MsbA across different P. syringae pathovars?

Understanding sequence variation in MsbA across different P. syringae pathovars requires sophisticated bioinformatic approaches:

  • Genome mining and multiple sequence alignment:

    • Extract msbA sequences from genome databases of diverse P. syringae strains

    • Perform multiple sequence alignments using tools like MUSCLE or MAFFT

    • Identify conserved domains and variable regions

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on msbA sequences

    • Compare msbA phylogeny with whole-genome or MLSA phylogenies

    • Identify instances of horizontal gene transfer or recombination

  • Selection pressure analysis:

    • Calculate dN/dS ratios to detect positive or purifying selection

    • Perform site-specific selection analysis to identify functionally important residues

    • Compare selection patterns across different pathovars

  • Structure-based sequence analysis:

    • Map sequence variations onto known MsbA structures

    • Identify variations in substrate-binding, nucleotide-binding, or dimerization interfaces

    • Predict functional consequences of sequence variations

P. syringae sensu lato consists of over 50 pathovars distributed across seven named species and one genomospecies . Multilocus sequence analysis and whole genome sequence analysis have been essential for distinguishing these groups and understanding their evolutionary relationships . This bioinformatic framework provides the foundation for analyzing MsbA variation in the context of P. syringae diversity.

How can researchers develop an effective expression system for recombinant P. syringae pv. syringae MsbA?

Developing an effective expression system for recombinant P. syringae pv. syringae MsbA requires careful consideration of several factors:

  • Expression vector selection:

    • Use vectors with appropriate promoters (e.g., T7, tac)

    • Include affinity tags (His-tag, FLAG-tag) for purification

    • Consider fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Incorporate TEV protease cleavage sites for tag removal

  • Expression host optimization:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Consider Lemo21(DE3) for tunable expression levels

    • Test P. syringae-based expression systems for native folding environment

  • Induction and growth conditions:

    • Optimize induction timing (mid-log phase typically optimal)

    • Test lower temperatures (16-20°C) to enhance proper folding

    • Evaluate different inducer concentrations (0.1-1.0 mM IPTG)

    • Consider auto-induction media for gradual protein expression

  • Membrane extraction and protein purification:

    • Use mild detergents (DDM, LMNG) for membrane solubilization

    • Implement two-step purification (IMAC followed by size exclusion)

    • Verify protein integrity by SDS-PAGE and Western blotting

    • Assess functional activity through ATPase assays

  • Reconstitution methods:

    • Prepare proteoliposomes with defined lipid compositions

    • Test nanodiscs for structural and functional studies

    • Consider amphipols for maintaining stability during functional assays

Successful expression and purification of active MsbA is critical for subsequent structural and functional studies, including those that have revealed its dual energy utilization mechanisms and conformational states during the transport cycle .

What methods can be used to assess MsbA transport activity in vitro?

Assessing MsbA transport activity in vitro requires specialized techniques that can monitor substrate translocation across membranes:

  • Fluorescent lipid analog transport assays:

    • Incorporate fluorescent lipid analogs (NBD-PE, dansyl-PE) into proteoliposomes

    • Monitor fluorescence changes upon translocation

    • Quantify transport rates under different nucleotide and pH conditions

  • Radiolabeled substrate transport:

    • Use 14C or 3H-labeled lipid A or other substrates

    • Measure time-dependent accumulation in vesicles or nanodiscs

    • Determine kinetic parameters (Km, Vmax) for different substrates

  • ATPase activity coupling measurements:

    • Correlate ATP hydrolysis rates with transport activity

    • Use coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) for real-time monitoring

    • Compare ATPase activity in the presence/absence of transport substrates

  • Proton gradient effects quantification:

    • Establish defined pH gradients across proteoliposome membranes

    • Measure transport rates as a function of ΔpH

    • Use pH-sensitive fluorescent dyes to monitor proton movement

  • Substrate competition assays:

    • Test multiple substrates simultaneously to assess specificity

    • Determine inhibitory concentrations and mechanisms

    • Identify substrate preference hierarchies

These methodologies should be designed to specifically investigate the unique aspects of MsbA function, including its ability to utilize both ATP and proton gradients as energy sources and the modulation of its activity by specific lipids like Kdo2-lipid A .

How can genome editing be used to study MsbA function in P. syringae pv. syringae?

Genome editing technologies provide powerful tools for studying MsbA function directly in P. syringae pv. syringae:

  • CRISPR-Cas9 system adaptation for P. syringae:

    • Design sgRNAs targeting msbA with minimal off-target effects

    • Develop appropriate delivery vectors for P. syringae

    • Include counterselectable markers for screening

  • Allelic replacement strategies:

    • Generate point mutations in critical residues (nucleotide binding, substrate binding)

    • Create domain deletions to assess functional contributions

    • Introduce epitope tags for in vivo localization and interaction studies

  • Conditional expression systems:

    • Implement inducible promoters to control MsbA expression levels

    • Develop depletion strains to study essentiality and phenotypic consequences

    • Create temperature-sensitive alleles for temporal control

  • Reporter gene fusions:

    • Construct transcriptional and translational fusions to monitor expression

    • Implement split-protein complementation assays for interaction studies

    • Develop FRET-based sensors to monitor conformational changes in vivo

  • Phenotypic characterization methodologies:

    • Assess membrane integrity using fluorescent dyes

    • Quantify antibiotic sensitivity profiles

    • Evaluate LPS production and transport

    • Measure plant virulence in infection models

These genome editing approaches should be designed within the context of P. syringae as a plant pathogen associated with diseases of numerous plant species, with particular attention to how MsbA function impacts pathogenicity and host-specificity .

How do different nucleotides affect the structural conformation of MsbA?

Native mass spectrometry and structural studies have revealed distinct effects of different nucleotides on MsbA conformation:

  • Nucleotide binding preferences:

    • MsbA demonstrates a higher affinity for ADP compared to ATP in the absence of substrate

    • This preference shifts toward ATP when Kdo2-lipid A (KDL) is present

    • The nucleotide selectivity modulation represents a regulatory mechanism

  • Structural transitions induced by nucleotides:

Nucleotide StatePredominant ConformationNBD ArrangementSubstrate Accessibility
Nucleotide-freeInward-facing (multiple forms)SeparatedCytoplasmic side
ADP-boundPartially closedPartially engagedLimited
ATP-boundOutward-facingFully engagedPeriplasmic side
Post-hydrolysisTransition statePartially disengagedMixed
  • Methodological approaches for structural analysis:

    • Cryo-EM with different nucleotides and nucleotide analogs

    • X-ray crystallography of locked conformational states

    • HDX-MS to monitor solvent accessibility changes

    • DEER spectroscopy to measure domain movements

  • Functional correlations:

    • ATP binding drives NBD dimerization

    • ATP hydrolysis triggers conformational changes necessary for substrate translocation

    • The return to the inward-facing conformation requires release of ADP and Pi

These structural transitions are essential components of the alternating access mechanism proposed for ABC transporters, with MsbA cycling between conformations with inward- and outward-facing substrate-binding sites in response to engagement and hydrolysis of ATP .

What is the relationship between proton gradient coupling and ATP utilization in MsbA transport?

The discovery that MsbA utilizes both ATP and a transmembrane electrochemical proton gradient represents a significant advance in understanding ABC transporter mechanisms:

  • Integration of energy sources:

    • ATP-dependent transport depends on proton coupling

    • Chemical proton gradients stimulate MsbA-ATPase activity

    • Both forms of metabolic energy are functionally integrated

  • Proposed mechanistic models:

Model ComponentDescriptionExperimental Evidence
Sequential couplingProton gradient primes MsbA for ATP utilizationStimulation of ATPase by ΔpH
Conformational controlProtons induce conformational changes that facilitate ATP bindingAltered nucleotide affinity under different pH conditions
Energy conservationDual energy sources enhance transport efficiencyHigher transport rates with both energy sources present
Substrate specificity modulationProton coupling may alter substrate preferencesDifferent transport profiles under varying pH conditions
  • Physiological significance:

    • Provides metabolic flexibility in changing environments

    • Allows fine-tuning of transport activity based on cellular energetic state

    • May contribute to antibiotic resistance mechanisms

  • Research implications:

    • Challenges the traditional ATP-only model for ABC transporters

    • Suggests proton coupling should be investigated in other ABC transporters

    • Highlights the need to consider multiple energy sources in transport studies

This integrated energy utilization represents a novel parameter in the mechanism of homodimeric ABC transporters and has implications for understanding their function in bacterial physiology and pathogenesis .

How does substrate binding affect MsbA dimerization and conformational changes?

Substrate binding, particularly of Kdo2-lipid A (KDL), induces significant effects on MsbA dimerization and conformational dynamics:

  • Substrate-induced conformational changes:

    • KDL binding at the exterior site stabilizes the open, outward-facing conformation

    • The substrate can modulate the selectivity of MsbA for ATP over ADP

    • These effects suggest allosteric communication between substrate and nucleotide binding sites

  • Dimerization interface alterations:

    • Substrate binding affects the association of the two monomers

    • The transmembrane helices undergo rearrangement to accommodate the substrate

    • NBD dimerization dynamics change in response to substrate presence

  • Substrate binding sites:

    • Interior binding site accessible in the inward-facing conformation

    • Exterior binding site accessible in the outward-facing conformation

    • Potential intermediate binding sites during translocation

  • Research methodologies:

    • Disulfide cross-linking to probe proximity changes

    • FRET measurements between labeled monomers

    • HDX-MS to identify regions with altered solvent accessibility

    • Native MS to directly observe substrate-bound dimeric species

Understanding these substrate-induced effects is crucial for developing a complete model of the MsbA transport cycle, where binding of substrate and nucleotides leads to coordinated conformational changes enabling directional transport across the membrane .

How does P. syringae pv. syringae MsbA compare to homologs in other bacterial species?

Comparative analysis of MsbA across bacterial species reveals important evolutionary insights:

  • Structural conservation:

    • Core ABC transporter architecture is preserved across species

    • Nucleotide binding domains show higher conservation than membrane domains

    • Key functional motifs (Walker A/B, signature motif) are highly conserved

  • Comparative features of MsbA homologs:

SpeciesKey DifferencesFunctional ImplicationsResearch Methods
E. coliWell-characterized model systemEstablished functional paradigmUsed for structural studies
P. syringaePlant pathogen contextRole in plant-pathogen interactionsGenomic comparisons
Other Pseudomonas spp.Species-specific variationsHost adaptation signaturesPhylogenetic analysis
Other Gram-negative bacteriaVariations in substrate specificityAdaptations to different LPS structuresComplementation studies
  • Evolutionary pressures:

    • Conservation of essential transport function

    • Adaptation to specific membrane environments

    • Co-evolution with LPS biosynthesis pathways

    • Selection pressure from antimicrobial compounds

  • Research approaches:

    • Phylogenetic analysis across bacterial species

    • Structural modeling based on evolutionary conservation

    • Horizontal gene transfer detection

    • Complementation experiments across species

These comparative analyses provide context for understanding MsbA function within P. syringae and its potential role in pathogenicity and host adaptation .

What evidence exists for horizontal gene transfer or recombination events affecting the msbA gene in P. syringae populations?

Analysis of horizontal gene transfer (HGT) and recombination events affecting msbA in P. syringae requires sophisticated genomic approaches:

  • Population genomics evidence:

    • Multilocus sequence analysis (MLSA) has been used to distinguish phylogroups within P. syringae

    • Whole genome sequence analysis helps identify potential HGT regions

    • The P. syringae sensu lato complex encompasses over 50 pathovars distributed across phylogroups

  • Recombination detection methods:

    • Incongruence between gene trees and species trees can indicate HGT

    • Abnormal GC content or codon usage patterns may suggest foreign origin

    • Breakpoint analysis can identify recombination junctions

  • Evolutionary implications:

    • Core genes like msbA typically show less evidence of HGT than accessory genes

    • Recombination events affecting essential transporters are constrained by functional requirements

    • Acquisition of variants may contribute to host adaptation or environmental fitness

  • Research approaches:

    • Genome sequencing of diverse strains across multiple outbreaks

    • Comparative genomic analysis to identify regions of anomalous sequence composition

    • Population structure analysis to detect admixture events

    • Experimental evolution to observe real-time recombination

Recent studies investigating the evolutionary processes leading to the emergence of epidemic P. syringae lineages have employed these approaches to understand patterns of gene acquisition and exchange in this pathogen complex .

How has MsbA function evolved in relation to LPS structure variations across Pseudomonas species?

The co-evolution of MsbA function and LPS structure represents an important aspect of bacterial adaptation:

  • LPS structural diversity:

    • Pseudomonas species exhibit variations in LPS composition

    • These differences affect membrane properties and host interactions

    • Lipid A modifications can influence antimicrobial resistance and immune recognition

  • Functional adaptation of MsbA:

    • Substrate recognition domains may co-evolve with LPS structure

    • Transport efficiency could be optimized for species-specific substrates

    • Regulatory mechanisms might be adapted to different cellular contexts

  • Evolutionary trajectories:

    • Purifying selection on core transport function

    • Diversifying selection on substrate specificity regions

    • Co-evolutionary signatures with LPS biosynthesis genes

  • Research methodologies:

    • Comparative biochemistry with purified MsbA from different species

    • Cross-species complementation studies

    • Chimeric protein construction to identify specificity determinants

    • Structural biology to identify substrate recognition elements

Understanding this co-evolutionary relationship provides insights into bacterial adaptation mechanisms and the functional constraints on essential membrane transporters in the context of bacterial pathogenesis .

How does MsbA function influence antibiotic resistance in P. syringae pv. syringae?

MsbA's role in LPS transport has significant implications for antibiotic resistance:

  • Membrane barrier function:

    • Proper LPS transport and assembly is essential for outer membrane integrity

    • The outer membrane forms a critical barrier against antibiotics

    • MsbA dysfunction can lead to increased permeability and antibiotic sensitivity

  • Antimicrobial peptide resistance:

    • LPS structure influences interactions with antimicrobial peptides

    • Altered MsbA activity could affect LPS modifications that confer resistance

    • Plant-derived antimicrobial compounds may exert selection pressure on MsbA function

  • Multidrug efflux capability:

    • MsbA can transport multiple substrates beyond LPS

    • This broader substrate specificity may contribute to efflux of certain antibiotics

    • Structural similarities to mammalian multidrug transporters suggest potential drug efflux functions

  • Research approaches:

    • Antibiotic susceptibility testing of strains with modified MsbA

    • Direct measurement of antibiotic transport by purified MsbA

    • Identification of resistance mutations in clinical and environmental isolates

    • Structure-guided design of inhibitors targeting MsbA

Understanding MsbA's contribution to antibiotic resistance is particularly important in the context of P. syringae as a plant pathogen with significant agricultural impact .

How can structural knowledge of MsbA be applied to develop inhibitors for controlling P. syringae infections?

Structural insights into MsbA provide a foundation for rational inhibitor design:

  • Targetable binding sites:

    • ATP binding pocket

    • Substrate binding sites (interior and exterior)

    • Transmembrane domain interfaces

    • Proton coupling pathway

  • Structure-based drug design strategies:

Target SiteInhibitor TypeMechanism of ActionDesign Approach
Nucleotide binding domainATP competitorsPrevent energy couplingStructure-based virtual screening
Substrate binding siteSubstrate analogsBlock transport cycleModification of natural substrates
Transmembrane regionConformation stabilizersLock protein in inactive stateFragment-based screening
Dimerization interfaceInterface disruptorsPrevent functional assemblyPeptide-based inhibitors
  • Screening methodologies:

    • High-throughput ATPase activity assays

    • Transport inhibition assays

    • Thermal shift assays to detect stabilizing compounds

    • Structure-guided virtual screening

  • Translational applications:

    • Agricultural antimicrobials for controlling plant diseases

    • Combination approaches targeting multiple bacterial systems

    • Resistance management strategies

Development of MsbA inhibitors would represent a novel approach to controlling P. syringae infections, which are responsible for numerous plant diseases of economic importance worldwide .

How can knowledge of MsbA function inform strategies for engineering bacterial strains with modified membrane properties?

Understanding MsbA function provides opportunities for bacterial membrane engineering:

  • Controlled LPS modifications:

    • Modulate MsbA expression or activity to alter LPS transport rates

    • Engineer MsbA variants with altered substrate specificity

    • Co-express modified LPS biosynthesis enzymes with compatible MsbA variants

  • Membrane permeability engineering:

    • Create strains with regulated MsbA function for controlled permeability

    • Develop inducible systems for temporary membrane modification

    • Engineer feedback loops between membrane stress and MsbA activity

  • Biotechnological applications:

    • Development of bacterial chassis with enhanced secretion capabilities

    • Engineering strains for improved heterologous protein production

    • Creating bacteria with custom-designed outer membrane properties

  • Research methodologies:

    • Directed evolution of MsbA for novel functions

    • Synthetic biology approaches to create membrane property circuits

    • Systems biology modeling of membrane transport networks

    • Biocontainment strategies based on engineered membrane dependencies

These engineering approaches have potential applications in agricultural biocontrol, bioremediation, and synthetic biology platforms, extending beyond the natural role of MsbA in bacterial physiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.