Recombinant Pseudomonas syringae pv. syringae Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Biological Role in Pseudomonas syringae

mtgA is implicated in peptidoglycan remodeling, a process essential for bacterial cell wall integrity and virulence. Key findings include:

  • Pathogenicity Link: MtgA is co-regulated with the hrp (hypersensitive response and pathogenicity) gene cluster in P. syringae, which encodes a type III secretion system (T3SS) for effector protein delivery into plant cells .

  • Genomic Context: The mtgA gene is located in the P. syringae pv. syringae B728a genome, which lacks plasmids but carries unique genomic islands associated with epiphytic fitness and stress tolerance .

  • Functional Redundancy: P. syringae encodes multiple LTs (e.g., hrpH, hopP1), but mtgA’s biosynthetic role suggests specialization in peptidoglycan synthesis rather than secretion system support .

Production Workflow

  • Expression System: Optimized in E. coli for high yield and solubility .

  • Purification: Affinity chromatography via His tag, followed by buffer exchange into storage-compatible formulations .

  • Reconstitution: Recommended in deionized water with glycerol (5–50%) to prevent aggregation .

Research Applications

  • Antibiotic Target Studies: As a peptidoglycan biosynthesis enzyme, mtgA is a candidate for inhibitor screens to develop antibacterial agents .

  • Structural Biology: Used in crystallography and mutagenesis to map active sites and substrate-binding regions .

  • Plant Pathology Models: Investigated in P. syringae-plant interactions to dissect virulence mechanisms .

Comparative Genomic Insights

P. syringae pv. syringae B728a’s genome lacks phaseolotoxin and coronatine toxin genes present in other pathovars but retains homologs of phaseolotoxin biosynthesis loci (e.g., phtE) . mtgA’s presence in B728a highlights its conserved role in cell wall metabolism across P. syringae strains, despite divergent virulence strategies .

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquot storage is critical .

  • Activity Assays: Requires reconstitution at 0.1–1.0 mg/mL, with glycerol to maintain enzymatic function .

Future Directions

  • Mechanistic Studies: Elucidate mtgA’s interplay with other LTs in peptidoglycan dynamics.

  • Biotechnological Engineering: Optimize mtgA for industrial applications, such as enzymatic lysis of bacterial cells.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.

Synonyms
mtgA; Psyr_4743; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
mtgA
Target Protein Sequence
MLQSILRRIVKALLWFAAGSVLVVLVLRWVPPPGTALMVERKVESWFDGEPIDLQRDWEP LDKISDNLKIAVIAGEDQKFAEHWGFDVDAIQAAILHNERGGSIRGASTLSQQVSKNLFL WSGRSYLRKGLEAWFTMLIELLWSKERILEVYLNSVEWDEGVFGAQAAAQHHFRTNASAL SAQQASYLAAVLPNPRQWSASHPSSYVSRRAGWIRQQMRQLGGDEYLQGLNSSRRW
Uniprot No.

Target Background

Function

Peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Pseudomonas syringae pv. syringae?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Pseudomonas syringae pv. syringae plays a critical role in bacterial cell wall synthesis by catalyzing the polymerization of lipid II substrates to form the peptidoglycan backbone. The enzyme specifically performs the transglycosylation reaction, creating β1-4 glycosidic bonds between N-acetylglucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) sugar moieties . This reaction is essential for maintaining cell wall integrity and bacterial shape. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase activities, mtgA is monofunctional, specializing exclusively in the glycosyltransferase reaction. The enzyme is considered non-lethal upon deletion but significantly affects cell morphology and potentially virulence characteristics of the bacterium .

How does the structure of mtgA relate to its enzymatic function?

The structure of mtgA, like other bacterial monofunctional glycosyltransferases, comprises several conserved motifs (I-V) that are critical for its catalytic activity. Based on structural studies of homologous enzymes, mtgA possesses two substrate-binding sites: a glycosyl acceptor site (S1) and a glycosyl donor site (S2) . The enzyme contains specific catalytic residues, including a glutamic acid residue (similar to E100 in S. aureus MGT) that acts as a general base to deprotonate the 4-OH of GlcNAc, facilitating nucleophilic attack on the C1 carbon of the donor substrate . The structure also includes positively charged residues (analogous to K140 and R148 in S. aureus MGT) that stabilize the pyrophosphate leaving group during the transglycosylation reaction . These structural elements create a catalytic environment that enables the sequential addition of disaccharide units to the growing peptidoglycan chain in a processive manner.

What expression systems are commonly used for producing recombinant mtgA?

For the production of recombinant monofunctional biosynthetic peptidoglycan transglycosylase from Pseudomonas syringae pv. syringae, researchers typically employ Escherichia coli expression systems. These systems offer several advantages including rapid growth, high protein yields, and established genetic manipulation protocols. The expression vector selection depends on research needs, with pET-based vectors being common choices due to their strong T7 promoter and tight regulation. For proper folding and activity of mtgA, expression conditions must be carefully optimized including temperature (often lowered to 16-25°C after induction), IPTG concentration (typically 0.1-0.5 mM), and duration (4-24 hours) . When expressing membrane-associated proteins like mtgA, researchers may use specialized E. coli strains such as C41(DE3) or C43(DE3) that are adapted for membrane protein expression. Purification typically involves immobilized metal affinity chromatography (IMAC) using histidine tags, followed by size exclusion chromatography to achieve high purity samples for enzymatic and structural studies .

What are the optimal conditions for measuring mtgA enzymatic activity in vitro?

The optimal conditions for measuring mtgA enzymatic activity in vitro require careful consideration of multiple parameters to ensure physiological relevance and reliable results. Based on protocols used for similar transglycosylases, the reaction buffer typically contains 50 mM HEPES or MES at pH 7.5, 10-25 mM MgCl₂ (as divalent cations are essential for activity), and 100-200 mM NaCl to maintain ionic strength . The assay temperature is generally set at 30°C for Pseudomonas enzymes, though temperature optimization may be necessary. For substrate preparation, lipid II analogues can be synthesized chemically or enzymatically and typically solubilized in detergent solutions (0.1% Triton X-100 or CHAPS) . Activity measurements commonly employ HPLC-based methods to monitor product formation, fluorescence-based assays using dansylated or fluorescamine-labeled lipid II, or coupled enzyme assays that detect the release of undecaprenyl pyrophosphate. When designing these experiments, researchers should include appropriate controls such as heat-inactivated enzyme, reactions without divalent cations, and known transglycosylase inhibitors like moenomycin to validate the specificity of the assay .

How can one perform site-directed mutagenesis to identify catalytic residues in mtgA?

To identify catalytic residues in mtgA through site-directed mutagenesis, researchers should begin with sequence alignment of mtgA with well-characterized homologs such as the S. aureus MGT to identify conserved amino acids in the five motifs critical for transglycosylase activity . Based on these analyses, candidate residues for mutagenesis should include the putative catalytic glutamate (equivalent to E100 in S. aureus MGT) and positively charged residues (equivalent to K140 and R148) that stabilize the pyrophosphate leaving group . For the mutagenesis procedure, researchers should use the QuikChange method or overlap extension PCR with primers containing the desired mutations. After confirmation of mutations by sequencing, the mutant proteins should be expressed and purified under identical conditions as the wild-type enzyme to ensure fair comparisons. Activity assays should be performed with multiple substrate concentrations to determine kinetic parameters (Km, kcat, and kcat/Km) for each mutant . To complement the kinetic data, researchers should consider thermal stability measurements using differential scanning fluorimetry to distinguish between mutations affecting catalysis versus protein stability. Additionally, crystallographic studies of key mutants in complex with substrates or substrate analogs can provide definitive structural insights into the roles of specific residues .

What are the methods for crystallizing mtgA for structural studies?

Crystallization of mtgA for structural studies requires specialized approaches due to its membrane association and potential flexibility. Based on successful strategies with similar enzymes, researchers should first optimize protein production to obtain highly pure, homogeneous samples (>95% purity by SDS-PAGE) . For membrane-associated forms of mtgA, the bicelle crystallization method has proven effective, as demonstrated with the S. aureus MGT . This approach involves reconstituting the purified protein in a mixture of long-chain and short-chain phospholipids (typically DMPC and CHAPSO at a 2.8:1 ratio) to mimic the membrane environment while maintaining solubility. Alternatively, researchers may design construct modifications by removing predicted flexible regions or transmembrane domains while preserving the catalytic domain. Co-crystallization with substrates, substrate analogs, or inhibitors (such as moenomycin) can stabilize the enzyme in a specific conformation, improving crystal quality . Screening crystallization conditions should include variations in pH (6.0-8.5), precipitant type and concentration, salt concentrations, and additives. Microseeding techniques often help improve crystal quality after initial crystallization hits are identified. For data collection, crystals should be cryoprotected using glycerol, ethylene glycol, or low molecular weight PEGs before flash-cooling in liquid nitrogen, and when possible, diffraction data should be collected at synchrotron radiation sources to achieve high resolution .

What is the evolutionary significance of monofunctional transglycosylases compared to bifunctional PBPs?

The evolutionary significance of monofunctional transglycosylases like mtgA compared to bifunctional penicillin-binding proteins (PBPs) represents a fascinating case of functional specialization in bacterial cell wall biosynthesis machinery. From an evolutionary perspective, monofunctional transglycosylases likely evolved as complementary enzymes to the bifunctional PBPs, allowing for more precise regulation of peptidoglycan synthesis and remodeling under varying environmental conditions . This separation of functions permits independent control of transglycosylation and transpeptidation reactions, potentially offering bacteria greater flexibility in cell wall metabolism. The presence of mtgA as a non-essential gene in many bacteria suggests it plays a specialized role that becomes particularly important under specific growth conditions or stress responses . Studies with E. coli have demonstrated that mtgA deletion results in altered cell morphology rather than lethality, highlighting its role in fine-tuning cell wall architecture rather than being absolutely required for viability . The conservation of mtgA across diverse bacterial species, including plant pathogens like Pseudomonas syringae and human pathogens like Staphylococcus aureus, indicates its fundamental importance in bacterial physiology despite being non-essential . From a structural standpoint, the monofunctional nature of mtgA may allow for optimization of the transglycosylase domain without constraints imposed by an adjacent transpeptidase domain, potentially resulting in enhanced catalytic efficiency for its specific reaction .

How do mutations in mtgA affect bacterial fitness and virulence in plant pathogens?

Mutations in the mtgA gene significantly impact bacterial fitness and virulence in plant pathogens through multiple mechanisms related to cell wall integrity and host interactions. In Pseudomonas syringae, which exhibits a high degree of host specificity and genetic monomorphism (as seen in pv. tomato with only 267 mutations identified across five isolates), alterations in cell wall synthesis enzymes like mtgA can have profound effects on adaptive fitness in plant environments . Deletion or mutation of mtgA likely affects cell morphology, as demonstrated in E. coli where mtgA deletion triggered cell enlargement . This morphological change may alter bacterial surface exposure of pathogen-associated molecular patterns (PAMPs) that are recognized by plant immune receptors, potentially modifying the intensity of PAMP-triggered immunity responses . In plant pathogens, cell wall modifications can affect bacterial resistance to plant antimicrobial compounds and osmotic stress encountered during infection. Furthermore, proper cell wall synthesis is crucial for the assembly and function of type III secretion systems, which deliver virulence effectors into plant cells . Experimental evidence with E. coli suggests that mtgA mutations can be beneficial under certain circumstances, as demonstrated by increased polymer accumulation in mtgA-deleted strains, indicating that such mutations might confer adaptive advantages in specific ecological niches . The non-lethal nature of mtgA mutations makes this gene a potential target for evolutionary adaptation in plant pathogens, allowing for subtle modifications in host-pathogen interactions without compromising bacterial viability .

How can mtgA be exploited as a target for antimicrobial development?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) presents a promising target for novel antimicrobial development due to its essential role in bacterial cell wall synthesis and several unique advantages over traditional antibiotic targets. Unlike the heavily exploited transpeptidases (targets of β-lactam antibiotics), transglycosylases have remained relatively underutilized in drug development despite their critical function . The only known natural product that directly inhibits transglycosylases is moenomycin, which binds to the glycosyl donor site but has poor pharmacokinetic properties preventing its clinical use . To develop effective mtgA inhibitors, researchers should focus on several strategic approaches. First, structure-based drug design utilizing crystallographic data of mtgA-substrate complexes can guide the development of small molecules that interfere with either the donor or acceptor binding sites . The conserved nature of the catalytic residues (equivalent to E100, K140, and R148 in S. aureus MGT) across bacterial species makes them particularly attractive targets . Second, high-throughput screening of compound libraries against purified recombinant mtgA can identify novel chemical scaffolds with inhibitory activity. Third, lipid II analogs that compete with natural substrates but cannot undergo transglycosylation represent another viable approach. For plant pathogens like P. syringae, mtgA inhibitors could serve as agricultural antimicrobials with potentially reduced environmental impact compared to current copper-based bactericides. The fact that mtgA mutations affect cell morphology without necessarily causing lethality suggests that mtgA inhibitors might also function as antivirulence agents that reduce pathogenicity without imposing the strong selective pressure that drives resistance development .

What experimental approaches can elucidate the role of mtgA in bacterial cell division and morphogenesis?

To thoroughly investigate mtgA's role in bacterial cell division and morphogenesis, researchers should implement a multi-faceted experimental approach combining genetic, microscopic, biochemical, and computational methods. First, precise genetic manipulation techniques should be employed, creating not only complete knockout mutants but also conditional mutants (using inducible promoters) and point mutations in catalytic residues to distinguish between structural and enzymatic functions of mtgA . Time-lapse fluorescence microscopy with fluorescently tagged mtgA and other cell division proteins (FtsZ, FtsI, MreB) can reveal dynamic localization patterns during the cell cycle, while super-resolution microscopy techniques (STORM, PALM) can provide nanoscale details of mtgA positioning within the divisome complex. Electron cryotomography can visualize the impact of mtgA mutations on peptidoglycan architecture at molecular resolution . Biochemically, in vitro peptidoglycan synthesis assays using purified components can determine mtgA's specific contribution to cell wall assembly, while bacterial two-hybrid or pull-down assays can identify protein interaction partners . Metabolic labeling of peptidoglycan with fluorescent D-amino acids or clickable probes enables visualization of nascent peptidoglycan synthesis patterns in wild-type versus mtgA mutant strains. For phenotypic characterization, researchers should analyze growth under various osmotic conditions, cell morphology using quantitative image analysis, and mechanical properties of the cell envelope using atomic force microscopy . Finally, genome-wide approaches including transcriptomics and proteomics of mtgA mutants can identify compensatory mechanisms and regulatory networks, while computational modeling of cell wall growth incorporating mtgA activity parameters can predict morphological outcomes of various mutations .

How might environmental factors influence mtgA expression and activity in Pseudomonas syringae during plant infection?

Environmental factors significantly modulate mtgA expression and activity in Pseudomonas syringae during plant infection through complex regulatory networks that respond to host conditions. Temperature fluctuations encountered during the infection cycle likely influence mtgA expression, with optimal enzyme activity potentially aligned with the pathogen's preferred temperature range for infection (typically 15-28°C for P. syringae) . The acidic apoplastic environment of plant tissues (pH 5.0-6.5) may necessitate pH-dependent regulation of mtgA expression or post-translational modifications that optimize enzyme function under acidic conditions. Nutrient availability, particularly carbon sources and essential minerals, can drastically affect cell wall biosynthesis pathways, with mtgA potentially upregulated during carbon limitation to restructure the cell wall for stress resistance . Plant-derived antimicrobial compounds encountered during infection, including phenolics and reactive oxygen species, may induce protective responses involving altered peptidoglycan synthesis through mtgA modulation. The microaerobic or anaerobic conditions within biofilms or plant tissues likely influence mtgA expression through oxygen-sensing regulatory systems. To investigate these environmental influences, researchers should employ RNA-seq analysis comparing mtgA expression profiles under various environmental conditions mimicking plant infection stages . Reporter gene fusions (mtgA promoter:GFP) can visualize expression patterns in planta using confocal microscopy. Chromatin immunoprecipitation sequencing (ChIP-seq) can identify transcription factors that regulate mtgA under different environmental conditions. In vitro activity assays of purified mtgA under varying pH, temperature, and ionic conditions can establish its environmental sensitivity . Additionally, comparing virulence of wild-type and mtgA mutants in plants grown under different environmental regimes can reveal condition-specific roles of mtgA in pathogenesis .

What is the role of mtgA in biofilm formation and maintenance?

The role of monofunctional transglycosylase mtgA in biofilm formation and maintenance involves multiple aspects of bacterial community development and architecture. As a peptidoglycan biosynthesis enzyme, mtgA likely contributes to cell envelope remodeling necessary for the transition from planktonic to sessile lifestyles during biofilm initiation . In established biofilms, the altered cell morphology observed in mtgA mutants (such as the enlarged cells seen in E. coli mtgA deletions) may significantly impact cell packing density and three-dimensional biofilm architecture . The enzymatic activity of mtgA in peptidoglycan synthesis affects cell surface properties, potentially altering adhesion capabilities and cell-cell interactions mediated by surface structures that anchor to the cell wall. In Pseudomonas species, which are known for their robust biofilm formation capabilities, mtgA may participate in the coordinated cell wall remodeling that occurs in response to surface contact sensing and quorum sensing signals during biofilm development . To investigate mtgA's biofilm-specific functions, researchers should employ confocal laser scanning microscopy with live/dead staining to compare biofilm structure, thickness, and viability between wild-type and mtgA mutant strains. Quantitative biofilm assays (crystal violet staining, Calgary biofilm device) can measure attachment strength and biomass production . Analysis of the extracellular polymeric substance (EPS) composition in mtgA mutant biofilms may reveal indirect effects on exopolysaccharide or extracellular DNA release. Transcriptomic analysis comparing planktonic and biofilm cells can identify co-regulated genes that function alongside mtgA in biofilm contexts. Flow cell biofilm systems coupled with time-lapse microscopy can capture dynamic aspects of biofilm formation in mtgA mutants, while dual-species biofilm experiments can assess whether mtgA mutations affect competitive fitness or interspecies interactions within mixed biofilms .

What are the current technical challenges in working with recombinant mtgA?

Working with recombinant monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) presents several technical challenges that researchers must overcome for successful biochemical and structural studies. First, membrane association of the native enzyme often leads to solubility issues during heterologous expression and purification . This challenge can be addressed by creating truncated constructs that remove transmembrane regions while preserving catalytic domains, or by using specialized detergents and membrane-mimetic systems like nanodiscs or bicelles for stabilization . Second, obtaining sufficient quantities of enzymatically active protein requires careful optimization of expression conditions, including temperature reduction to 16-20°C during induction, addition of membrane-stabilizing additives to growth media, and selection of appropriate E. coli expression strains (such as C41(DE3) or Lemo21(DE3)) designed for membrane proteins . Third, the processive nature of transglycosylases complicates kinetic analysis, as intermediate products can serve as subsequent substrates, making conventional enzyme kinetic models insufficient . Fourth, the preparation of natural substrates (lipid II) is technically demanding and expensive, often requiring multi-step enzymatic or chemical synthesis. Researchers can develop fluorescently labeled or biotinylated substrate analogs to facilitate high-throughput activity assays . Fifth, structural studies are hindered by protein flexibility and heterogeneity, which can be addressed through ligand-induced stabilization using substrate analogs or inhibitors like moenomycin . Finally, functional redundancy with bifunctional PBPs can mask phenotypes in genetic studies, necessitating the creation of conditional or multiple mutants to fully evaluate mtgA's physiological roles .

What future research directions might yield breakthrough insights about monofunctional transglycosylases?

Future research on monofunctional transglycosylases like mtgA should pursue several promising directions to achieve breakthrough insights. First, cryo-electron microscopy (cryo-EM) studies of mtgA in complex with lipid II and growing glycan chains could visualize the full catalytic cycle, capturing conformational changes during processive polymerization that have eluded crystallographic approaches . Second, single-molecule fluorescence techniques tracking individual enzyme molecules on membrane surfaces could reveal the dynamics and processivity of transglycosylation in real-time, providing unprecedented mechanistic details . Third, comprehensive analysis of natural variation in mtgA sequences across Pseudomonas syringae pathovars could identify adaptive mutations that correlate with host specificity or virulence, similar to the evolutionary patterns observed in P. syringae pv. tomato . Fourth, development of cell-free peptidoglycan synthesis systems reconstituting the entire wall assembly machinery would allow precise manipulation of component ratios and conditions to determine how mtgA cooperates with other enzymes . Fifth, CRISPR interference approaches enabling tunable repression of mtgA in combination with other cell wall synthesis genes could map genetic interaction networks and identify synthetic lethal relationships. Sixth, investigation of potential regulatory post-translational modifications of mtgA (phosphorylation, acetylation) might uncover mechanisms controlling its activity in response to environmental cues . Seventh, exploration of mtgA's potential moonlighting functions beyond peptidoglycan synthesis could reveal unexpected roles in signaling or metabolism. Finally, interdisciplinary approaches combining structural biology, synthetic biology, and computational design could lead to engineered mtgA variants with novel activities or substrate specificities for biotechnological applications . These research directions would not only advance our fundamental understanding of bacterial cell wall biogenesis but could also inform the development of new antimicrobial strategies targeting this essential process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.