Recombinant Pseudomonas syringae pv. syringae NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Psyr_3197; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
nuoA
Target Protein Sequence
MPESTGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRSKNEPFESGMLPTGSARL RLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGA LDWAPEGRRNRQAKLKQ
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase in Pseudomonas syringae?

NADH-quinone oxidoreductase plays a crucial role in electron transfer processes in Pseudomonas species. Similar to other bacterial systems, these enzymes catalyze the transfer of electrons from NADPH to quinones, which is essential for cellular respiration and detoxification of synthetic compounds. In P. syringae, quinone oxidoreductases have been characterized as NAD(P)H-dependent and capable of catalyzing one-electron reduction of certain quinones to generate semiquinone . This activity contributes to the organism's ability to detoxify harmful chemicals encountered during host invasion or environmental stress conditions .

How are quinone oxidoreductases in Pseudomonas syringae structurally organized?

Crystal structures of quinone oxidoreductase from Pseudomonas syringae pv. tomato DC3000 (PtoQOR) reveal a homologous dimeric structure, with each monomer containing two domains. The enzyme exhibits a bi-modular architecture that includes a NADPH-binding groove and a substrate-binding pocket in each subunit . When NADPH binds to PtoQOR, it localizes in the groove between the two domains, causing significant conformational changes in the enzyme structure. This conformational shift is crucial for catalytic activity and reflects the enzyme's dynamic nature during redox reactions .

What are the established methods for expressing recombinant proteins from Pseudomonas syringae?

Expression of recombinant proteins from P. syringae typically involves PCR amplification of the target gene from the bacterial genome, followed by cloning into an appropriate expression vector such as pET28a. Specific methods include:

  • PCR amplification of the gene with primers containing 20-bp sequences identical to the linearized plasmid sequence

  • Recombination of the PCR product with a BamHI-linearized pET28a vector using recombinase (e.g., Vazyme ClonExpress II One Step Cloning Kit)

  • Transformation into E. coli (DH5α) competent cells

  • Verification of successful constructs by restriction digestion or sequencing

  • Expression in suitable E. coli strains under appropriate conditions

This methodology has been successfully applied to numerous P. syringae proteins and can be adapted for nuoA expression.

What are the optimal conditions for recombineering in Pseudomonas syringae?

Recombineering in P. syringae is most effective when utilizing the native RecTE homologs identified in P. syringae pv. syringae B728a. The optimal conditions include:

  • Expression of both RecT and RecE homologs for efficient recombination of double-stranded DNA

  • Expression of only the RecT homolog is sufficient for single-stranded DNA oligonucleotide recombination

  • Introduction of linear DNA substrates by electroporation

  • Use of a constitutive BAD promoter (P::nptII) for expression of recombination proteins

  • Selection of transformants using appropriate antibiotics (typically kanamycin at 100 μg/ml for P. syringae)

Recombineering efficiency can be quantitatively assessed based on recombination frequency metrics, with protocols optimized to achieve higher transformation rates .

How can I create targeted gene knockouts or modifications of nuoA in Pseudomonas syringae?

A reliable method for targeted gene modification in P. syringae involves a SacB-based strategy using suicide plasmids:

  • Digest the pK18mobsacB suicide plasmid with appropriate restriction enzymes (EcoRI and HindIII)

  • Amplify ~1500 bp upstream and ~1000 bp downstream of the nuoA open reading frame

  • Digest and ligate these fragments together using T4 DNA ligase

  • Insert the ligated products into the digested pK18mobsacB plasmid using a one-step cloning kit

  • Electroporate the constructed plasmid into P. syringae

  • Select for kanamycin resistance initially, then for loss of sucrose susceptibility on KB agar plates containing 5% sucrose

  • Confirm the deletion mutant by RT-qPCR to verify absence of nuoA mRNA

This approach yields a clean deletion mutant without antibiotic resistance markers in the final strain.

What methods are recommended for assessing promoter activity of nuoA or related genes?

Promoter activity can be reliably measured using a luciferase reporter system:

  • Clone the promoter sequence into a promoter-less plasmid like pMS402 containing the luciferase gene

  • Digest the pMS402 plasmid with BamHI prior to cloning

  • Electroporate the constructed plasmid into mutant and wild-type P. syringae strains

  • Culture transformants to mid-log growth phase (OD600 = 0.6)

  • Measure luminescence using a 96-well white microplate reader

  • Determine optical density (OD600) immediately after luminescence reading

  • Calculate promoter activity as the ratio of luminescence value to OD600 value

This approach provides quantitative data on promoter strength and regulation under various experimental conditions.

How does the substrate-binding pocket of quinone oxidoreductases in P. syringae compare to other bacterial species?

The substrate-binding pocket of PtoQOR from P. syringae pv. tomato DC3000 has distinctive features compared to other bacterial species:

  • The putative substrate-binding site is wider than that found in Escherichia coli and Thermus thermophilus HB8

  • In T. thermophilus HB8 QOR, the entrance to the substrate-binding pocket is blocked by residues L50, A51, and W243, restricting access to large substrates like phenanthrenequinone

  • In contrast, PtoQOR's substrate-binding pocket is guarded by A57, A56, and Q292, creating a larger opening that accommodates more substrates

  • This structural difference explains why PtoQOR exhibits weak 1,4-benzoquinone catalytic activity but strong reduction activity toward larger substrates like 9,10-phenanthrenequinone

These structural distinctions have significant implications for substrate specificity and catalytic function.

What conformational changes occur during substrate binding and catalysis in quinone oxidoreductases?

NADPH binding to PtoQOR induces significant conformational changes essential for catalysis:

  • When NADPH binds, it positions in the groove between the two domains of each monomer

  • This binding triggers conformational shifts that prepare the enzyme for substrate interaction

  • When quinone enters the active pocket, it is positioned by interactions with specific residues (such as R45, Q48, Y54, C147, and T148 in similar QORs) and the NADPH nicotinamide ring

  • Electron transfer occurs when the phenyl ring of quinone stacks against the nicotinamide ring

  • Increased hydrophobicity around the positively charged nicotinamide cavity stimulates electron transfer

  • After reduction of the quinone carbonyl group, hydrogen bonds between quinone and specific residues are broken

  • The substrate-binding pocket then opens to release the reduced product

This dynamic conformational cycle is critical for the enzyme's function in electron transfer reactions.

How can I design experiments to investigate the potential role of nuoA in virulence of Pseudomonas syringae?

Investigating nuoA's role in virulence requires a multifaceted approach:

  • Create a clean nuoA deletion mutant using the SacB-based strategy

  • Complement the mutant with native and modified versions of nuoA to confirm phenotypes

  • Assess bacterial growth in planta using both wild-type and mutant strains

  • Measure virulence-associated phenotypes including:

    • Bacterial growth curves in host tissue

    • Symptom development (chlorosis, lesion formation)

    • Production of virulence factors

  • Conduct transcriptional profiling to identify genes co-regulated with nuoA during infection

  • Perform plant defense response assays to determine if nuoA affects host immunity

  • Use reporter assays to examine nuoA expression during different stages of infection

This approach can reveal whether nuoA functions as part of the core virulence machinery or plays a more specialized role in pathogen fitness.

What techniques can be used to identify protein-protein interactions involving nuoA in Pseudomonas syringae?

Several complementary approaches can be used to identify nuoA protein interaction partners:

  • Bacterial two-hybrid (B2H) screening against a P. syringae genomic library

  • Co-immunoprecipitation with epitope-tagged nuoA followed by mass spectrometry

  • Pull-down assays using purified nuoA protein and bacterial lysates

  • Chemical crosslinking followed by mass spectrometry (CXMS) to capture transient interactions

  • Surface plasmon resonance (SPR) to analyze binding kinetics with candidate partners

  • In situ proximity ligation assays to visualize interactions within bacterial cells

  • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

These methods can be validated by reciprocal approaches and functional studies of identified partners.

How does temperature affect the stability and activity of quinone oxidoreductases in P. syringae?

Temperature affects quinone oxidoreductases in P. syringae through multiple mechanisms:

To accurately measure these effects, researchers should:

  • Conduct thermal shift assays to determine protein melting temperature

  • Measure enzyme activity across a temperature range (15-40°C)

  • Analyze structural stability using circular dichroism spectroscopy

  • Compare temperature effects under different substrate concentrations

What statistical approaches are most appropriate for analyzing quinone oxidoreductase activity data?

For rigorous analysis of quinone oxidoreductase activity data:

  • Use at least three biological replicates and three technical replicates for each experiment

  • Apply appropriate transformation (log or square root) if data violates normality assumptions

  • For comparing activity across multiple conditions or mutants:

    • Use one-way ANOVA followed by Tukey's HSD post-hoc test for multiple comparisons

    • Apply two-way ANOVA when examining interactions between factors (e.g., temperature and pH)

  • For enzyme kinetics data:

    • Use non-linear regression to fit Michaelis-Menten or other appropriate models

    • Calculate confidence intervals for Km and Vmax parameters

    • Apply F-test to compare different kinetic models

  • For time-course experiments:

    • Consider repeated measures ANOVA or mixed-effects models

    • Use area under the curve (AUC) analysis when appropriate

All statistical analyses should be performed using established software like R, GraphPad Prism, or equivalent packages.

How should research data on recombinant nuoA be organized for NIH grant applications?

For NIH grant applications involving research on recombinant nuoA, data should be organized according to specific NIH data table formats:

Table NumberDescriptionContent for nuoA Research
Table 1Census of Participating DepartmentsList departments involved in nuoA research with faculty counts
Table 2Participating Faculty MembersNames and expertise of all researchers working on nuoA
Table 3Federal Institutional Research Training Grant SupportAny training grants supporting nuoA research
Table 4Research Support of Participating FacultyCurrent funding sources for all nuoA researchers
Table 5Publications of Those in TrainingPublications by trainees working on nuoA projects
Table 8Program OutcomesOutcomes of previous nuoA-related research initiatives

When preparing these tables:

  • Present complete information for each category

  • Maintain consistent formatting as specified in NIH guidelines

  • Ensure data accuracy and use the most current information

  • Include only relevant grants (exclude pending reviews and no-cost extensions)

  • Clearly highlight how the proposed nuoA research builds on previous work

This organized presentation significantly strengthens the application by demonstrating institutional capacity and research environment quality.

What are common challenges in purifying active recombinant nuoA protein and how can they be addressed?

Purifying active recombinant nuoA protein presents several challenges:

  • Inclusion body formation:

    • Solution: Optimize expression conditions by lowering temperature (16-20°C), reducing IPTG concentration (0.1-0.5 mM), or using specialized E. coli strains (Rosetta, Arctic Express)

    • Alternative approach: Use fusion tags like MBP or SUMO to enhance solubility

  • Loss of cofactors during purification:

    • Solution: Supplement purification buffers with appropriate cofactors (NAD(P)H, FAD)

    • Monitor spectroscopically for cofactor binding throughout purification

  • Oxidative damage:

    • Solution: Include reducing agents (2-5 mM DTT or β-mercaptoethanol) in all buffers

    • Perform purification under anaerobic conditions when possible

  • Protein instability:

    • Solution: Screen buffer conditions (pH 6.5-8.5, salt concentration 50-500 mM)

    • Add stabilizing agents such as glycerol (10-20%) or specific substrates

  • Low activity after purification:

    • Solution: Verify protein folding using circular dichroism

    • Implement activity-based screening during purification to track active fractions

    • Consider reconstitution experiments with cofactors post-purification

For initial purification strategy development, compare results from both IMAC (nickel) and affinity chromatography approaches to identify the optimal method.

How can I resolve inconsistent results when measuring quinone oxidoreductase activity?

When facing inconsistent quinone oxidoreductase activity measurements:

  • Standardize enzyme preparation:

    • Use consistent cell growth conditions (medium, temperature, harvest time)

    • Standardize protein extraction and purification protocols

    • Quantify protein concentration using multiple methods (Bradford, BCA, and A280)

  • Control assay conditions:

    • Prepare fresh substrate solutions for each experiment

    • Maintain consistent temperature (±0.5°C) during measurements

    • Use temperature-equilibrated buffers and reagents

    • Control oxygen levels if the enzyme is oxygen-sensitive

  • Optimize assay parameters:

    • Determine linear range for enzyme concentration and reaction time

    • Validate spectrophotometric assays by HPLC or other methods

    • Run parallel assays with known standards or commercial enzymes

  • Address technical variables:

    • Calibrate instruments before each set of measurements

    • Use the same batch of reagents throughout comparative studies

    • Document and control for environmental factors (light exposure, vibration)

  • Data analysis improvements:

    • Calculate initial rates only from the linear portion of progress curves

    • Apply appropriate blank corrections for all measurements

    • Use statistical tests to identify and handle outliers appropriately

Maintaining detailed laboratory records of all variables will help identify sources of inconsistency.

How might CRISPR-Cas systems be adapted for precise modification of nuoA in Pseudomonas syringae?

CRISPR-Cas systems can be adapted for precise modification of nuoA in P. syringae through several specialized approaches:

  • Development of optimized delivery systems:

    • Construct CRISPR-Cas delivery vectors based on broad-host-range plasmids compatible with P. syringae

    • Use conditional suicide vectors for transient expression followed by removal of CRISPR components

  • Custom sgRNA design for nuoA targeting:

    • Select target sites with minimal off-target effects using P. syringae-specific prediction algorithms

    • Design sgRNAs with optimal GC content (40-60%) and secondary structure for stability in P. syringae

  • Cas9 variants with improved function in P. syringae:

    • Test thermostable Cas9 variants that may function better at P. syringae's optimal growth temperature

    • Consider alternative Cas proteins (Cas12a/Cpf1) that might offer advantages for certain modifications

  • Precise repair templates:

    • Design HDR templates with homology arms of 500-1000 bp for optimal recombination efficiency

    • Include silent mutations in the PAM site to prevent re-cutting after successful editing

  • Selection strategies:

    • Implement CRISPR-based counterselection methods to enrich for edited cells

    • Develop scarless genome editing approaches by coupling with recombineering using P. syringae RecTE system

  • Validation approaches:

    • Whole-genome sequencing to confirm on-target editing and assess off-target effects

    • Phenotypic characterization to ensure edited strains maintain expected physiological properties

This CRISPR-based approach would complement existing recombineering techniques and increase editing precision.

What potential biotechnological applications exist for engineered nuoA variants with altered substrate specificity?

Engineered nuoA variants with altered substrate specificity offer several promising biotechnological applications:

  • Bioremediation technologies:

    • Development of P. syringae strains with enhanced ability to degrade specific environmental pollutants

    • Creation of immobilized enzyme systems for detoxification of industrial effluents containing toxic quinones

  • Biosensors for environmental monitoring:

    • Design of whole-cell biosensors using nuoA variants coupled to reporter systems

    • Development of electrochemical sensors with immobilized nuoA variants for detecting specific quinone compounds

  • Biocatalysis for pharmaceutical synthesis:

    • Engineering nuoA variants capable of stereoselective reduction of complex quinones for drug precursor synthesis

    • Creation of enzyme variants with stability in organic solvents for industrial biocatalytic applications

  • Agricultural applications:

    • Development of modified P. syringae strains with altered redox metabolism for biological control

    • Engineering plants to express modified nuoA for enhanced stress resistance

  • Fundamental research tools:

    • Creation of nuoA variants with altered cofactor specificity (NADH vs. NADPH preference)

    • Development of chimeric proteins combining nuoA with other functional domains for specialized research applications

The broad substrate flexibility observed in quinone oxidoreductases makes them particularly amenable to protein engineering approaches for these applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.