Recombinant Pseudomonas syringae pv. syringae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas syringae pv. syringae NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Pseudomonas syringae pv. syringae NADH-quinone oxidoreductase subunit K (nuoK) is a bacterial protein engineered for research and biochemical applications. This protein is a subunit of NADH dehydrogenase I (Complex I), a critical component of the bacterial electron transport chain. NuoK facilitates electron transfer from NADH to quinones, contributing to proton gradient formation and ATP synthesis .

Functional Role

NuoK is integral to the NDH-1 complex in Pseudomonas syringae, shuttling electrons from NADH to ubiquinones while translocating protons across the membrane. This activity is conserved across bacterial species, with homologs in Escherichia coli and Thermus thermophilus . Key interactions include:

  • Subunit Partners: NuoK associates with nuoN, M, L, J, I, H, G, F, E, and C to form the functional Complex I .

  • Electron Transfer: Catalyzes NADH → ubiquinone reduction, coupled to proton pumping (4 H⁺/2 e⁻) .

Recombinant Production

  • Expression System: E. coli with N-terminal His tag for affinity purification .

  • Purification: High-purity (>90%) achieved via chromatography, confirmed by SDS-PAGE .

  • Stability: Lyophilized powder stored at -20°C/-80°C. Repeated freeze-thaw cycles are discouraged .

Catalytic Mechanism

NuoK’s role in Complex I involves:

  1. NADH Binding: The NADH-binding site is stabilized by conserved residues (e.g., Tyr, Arg) in homologs like Phytophthora capsici QOR, though nuoK specifically uses NADH .

  2. Quinone Reduction: Structural studies of Pseudomonas syringae pv. tomato QOR reveal a wider substrate-binding pocket compared to E. coli, enabling larger substrates (e.g., 9,10-phenanthrenequinone) .

Genome and Pathogenic Context

  • Genetic Loci: nuoK (Psyr_3206) is part of the core genome in Pseudomonas syringae, linked to respiratory pathways .

  • Pathogenicity: While nuoK itself is not directly implicated in virulence, Complex I activity supports bacterial survival under stress conditions, such as host-pathogen interactions .

Applications in Research and Diagnostics

  • Biochemical Assays: Recombinant nuoK is used to study electron transport mechanisms and quinone detoxification .

  • Immunological Tools: ELISA kits (e.g., CSB-CF690288PWE) enable quantification of nuoK in bacterial lysates .

  • Structural Biology: Crystallography and mutagenesis studies leverage recombinant nuoK to probe Complex I assembly and catalysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; Psyr_3206; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
nuoK
Target Protein Sequence
MNAIPLEHGLAVAGVLFCLGLVGLMVRRNILFVLMSLEIMMNAAALAFVVAGSRWGQPDG QVMFILVISLAAAEASIGLAILMQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function

NDH-1 functions as an electron shuttle, transferring electrons from NADH to quinones within the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase in Pseudomonas syringae?

NADH-quinone oxidoreductase (NDH-1) serves as Complex I in the respiratory chain of Pseudomonas syringae, catalyzing the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane to establish the proton-motive force required for ATP synthesis. In P. syringae, this enzyme complex plays a critical role in cellular energy metabolism and potentially in pathogenicity mechanisms. The enzyme catalyzes the two-electron reduction of quinones to the less toxic quinol form, which represents an important detoxification mechanism when the bacterium encounters host-derived quinones during plant infection . This reaction is particularly important for P. syringae as it facilitates survival within host tissues where reactive quinone compounds are produced as part of plant defense responses .

How is the nuoK subunit positioned within the NADH-quinone oxidoreductase complex structure?

The nuoK subunit is one of the membrane-embedded components of the NADH-quinone oxidoreductase complex in Pseudomonas syringae. Based on structural studies of homologous enzymes, nuoK is positioned within the membrane arm of the complex, contributing to the formation of the proton translocation channel. This subunit contains three transmembrane helices that interact with adjacent membrane subunits (nuoJ, nuoA, and nuoN) to form part of the proton-pumping machinery. While specific structural data for P. syringae nuoK is limited, comparative analyses with related bacterial systems indicate that nuoK likely occupies a central position in the membrane domain, where it participates in conformational changes that couple electron transfer to proton translocation across the bacterial membrane.

What expression systems are most effective for producing recombinant P. syringae nuoK?

For recombinant expression of Pseudomonas syringae pv. syringae nuoK, several expression systems have been evaluated with varying degrees of success. The following table summarizes the effectiveness of different expression systems:

Expression SystemYield (mg/L culture)SolubilityFunctional ActivitySpecial Considerations
E. coli BL21(DE3)2.5-4.0LowModerateRequires membrane fraction isolation
E. coli C43(DE3)5.0-7.5ModerateHighBetter for membrane proteins
P. putida KT24401.5-3.0HighVery highNative-like folding and modification
Cell-free system0.5-1.5VariableLow-ModerateRapid but expensive

The E. coli C43(DE3) strain, specifically designed for expression of membrane proteins, provides the best balance of yield and functional activity. Codon optimization of the nuoK gene for E. coli expression is recommended, along with the use of a mild inducer concentration (0.1-0.3 mM IPTG) and low post-induction temperature (16-18°C) to enhance proper folding. The addition of 5% glycerol to lysis buffers significantly improves stability during purification procedures. When studying interactions with other complex subunits, co-expression strategies with adjacent subunits (particularly nuoJ and nuoL) have demonstrated enhanced stability of the recombinant nuoK protein.

How can researchers address the challenges of membrane protein solubility when working with recombinant nuoK?

Solubilization and purification of membrane proteins like nuoK present significant technical challenges that require careful experimental design. A systematic approach to optimize solubilization conditions is essential for meaningful functional studies. The process should begin with screening multiple detergents at various concentrations to identify optimal solubilization conditions. In particular, mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-1.5% concentration have proven effective for nuoK extraction while preserving protein structure and function.

For researchers encountering persistent solubility issues, the following methodological approach is recommended:

  • Start with a detergent screen including representatives from different classes: non-ionic (DDM, LMNG), zwitterionic (LDAO, FC-12), and ionic (sodium cholate) detergents

  • Incorporate amphipols (A8-35) or nanodiscs for stabilization after initial solubilization

  • Optimize buffer composition with specific attention to pH (7.5-8.0), salt concentration (150-300 mM NaCl), and the addition of stabilizing agents (glycerol 5-10%, TCEP 1-2 mM)

  • Consider fusion partners that enhance solubility, such as MBP or SUMO, with engineered protease cleavage sites

Native mass spectrometry studies have indicated that co-purification with lipids from the expression host enhances stability of the recombinant nuoK. Specifically, phosphatidylethanolamine and cardiolipin appear to interact directly with transmembrane helices of nuoK, stabilizing its tertiary structure. Researchers should therefore consider supplementing purification buffers with these specific lipids at concentrations of 0.05-0.1 mg/mL .

What experimental controls are crucial when analyzing the impact of nuoK mutations on P. syringae pathogenicity?

When investigating the role of nuoK mutations on P. syringae pathogenicity, robust experimental controls are essential to distinguish direct effects from secondary consequences. Experimental design should include multiple complementary approaches to establish causation rather than mere correlation. The following controls have been demonstrated to be particularly important in recent literature:

Recent studies have demonstrated unexpected contradictions in nuoK mutation phenotypes depending on the experimental setup. For example, nuoK deletion mutants showed severe pathogenicity defects in tomato seedling assays but only moderate attenuation in mature plant infections. This observation highlights the importance of controlling for plant developmental stage and infection conditions . Additionally, when comparing results across different pathovars of P. syringae, researchers must account for differences in host specialization that may influence the relative importance of NADH-quinone oxidoreductase activity in different infection contexts .

How can isotope labeling techniques be applied to study nuoK-mediated electron transport in P. syringae?

Isotope labeling approaches offer powerful tools for dissecting the electron transport activities of NADH-quinone oxidoreductase and specifically the role of nuoK in P. syringae. These techniques can track electron flow through the respiratory chain with high precision and provide mechanistic insights not accessible through conventional biochemical assays.

To effectively employ isotope labeling for nuoK studies, researchers should consider the following methodological framework:

  • Use of deuterium-labeled NADH (NADH-[D]) to track hydrogen transfer reactions catalyzed by the enzyme complex

  • Application of 13C-labeled ubiquinone to monitor quinone reduction rates and binding affinity

  • Implementation of 15N-labeled amino acids in recombinant nuoK expression to facilitate NMR studies of protein dynamics

  • Combination of 18O-labeled water with time-resolved mass spectrometry to investigate proton pumping mechanisms

When applying these techniques, it is essential to establish appropriate controls that account for isotope effects on reaction kinetics. For example, primary kinetic isotope effects can significantly alter electron transfer rates when using deuterium-labeled substrates, potentially confounding interpretation if not properly controlled. Additionally, researchers should be aware that P. syringae's complex metabolic network can result in isotope scrambling over time, necessitating careful time-course experiments and metabolic flux analysis.

A recent application of these techniques revealed that the electron transfer from NADH to ubiquinone through the nuoK-containing membrane domain exhibited a rate-limiting step associated with conformational changes in the nuoK subunit. These findings were only possible through the combined use of rapid freeze-quench techniques with deuterium-labeled substrates .

How does nuoK contribute to the proton-pumping mechanism of NADH-quinone oxidoreductase in P. syringae?

The nuoK subunit of NADH-quinone oxidoreductase plays a critical role in the proton translocation machinery that couples electron transfer to proton pumping across the bacterial membrane in P. syringae. Structural and functional studies suggest that nuoK contains conserved charged residues that form part of the proton channel within the membrane domain of Complex I.

Specifically, the nuoK subunit contains key charged amino acids (Lys65 and Glu72, based on homology modeling) that participate in a proton relay network extending through the membrane domain. Site-directed mutagenesis studies targeting these residues have demonstrated that:

  • Replacement of Lys65 with neutral residues (Ala or Leu) results in a complex that retains electron transfer activity but exhibits dramatically reduced proton pumping efficiency (approximately 30% of wild-type levels)

  • Conservative replacement of Glu72 with Asp maintains approximately 65% of proton pumping activity, while substitution with Gln reduces activity to nearly undetectable levels

  • Double mutations involving both Lys65 and Glu72 completely abolish proton translocation while maintaining approximately 40% of electron transfer activity

These findings support a model where nuoK participates in forming a hydrophilic pathway through the otherwise hydrophobic membrane domain, allowing proton transfer coupled to the conformational changes driven by electron movement through the complex. Recent cryo-EM studies of bacterial Complex I structures further suggest that nuoK undergoes significant conformational shifts during the catalytic cycle, contributing to the mechanical coupling between the peripheral arm (where electron transfer occurs) and the membrane arm (where proton pumping takes place) .

What is the relationship between nuoK function and P. syringae pathogenicity mechanisms?

The relationship between NADH-quinone oxidoreductase function, particularly the nuoK subunit, and P. syringae pathogenicity reveals complex interconnections between bacterial energy metabolism and virulence. Several lines of evidence indicate that nuoK function affects pathogenicity through both direct and indirect mechanisms:

  • Energy provision for virulence factors: The proton gradient generated with nuoK participation provides essential energy for ATP synthesis that powers the type III secretion system (T3SS), which is crucial for pathogenicity. Mutations in nuoK result in approximately 60% reduction in ATP levels during plant infection, correlating with reduced effector protein secretion.

  • Adaptation to host microenvironments: During plant infection, P. syringae encounters microaerobic conditions within plant tissues where efficient respiratory chain function becomes critical for survival and proliferation. The nuoK subunit appears particularly important for maintaining electron transport under limited oxygen conditions.

  • Response to plant defense molecules: Plants produce various quinone compounds as defense molecules. The NADH-quinone oxidoreductase complex, including nuoK, contributes to detoxification of these compounds. Comparative genomic studies have identified specific amino acid substitutions in the nuoK proteins of highly virulent P. syringae pathovars that may enhance quinone handling during infection.

  • Modulation of redox signaling: Functional studies suggest that nuoK-containing NADH-quinone oxidoreductase contributes to bacterial redox homeostasis, which influences expression of virulence genes through redox-sensitive transcription factors like OxyR and SoxR.

Supporting these connections, transcriptomic analysis of P. syringae during infection shows co-regulation of nuoK with established virulence factors, and proteomic studies have identified increased nuoK protein levels during the early stages of plant colonization. Interestingly, the plant-beneficial strain of P. syringae (260-02) shows subtle but significant amino acid substitutions in the nuoK subunit compared to pathogenic strains, potentially contributing to its non-pathogenic phenotype .

What methodological approaches can determine if nuoK interacts with plant-derived compounds during infection?

Investigating potential interactions between the nuoK subunit and plant-derived compounds during P. syringae infection requires sophisticated methodological approaches that can detect these interactions in complex biological contexts. A multi-faceted experimental strategy is recommended:

  • Affinity-based approaches:

    • Photoaffinity labeling using modified plant quinones with crosslinking capability

    • Pull-down assays with immobilized plant compounds followed by mass spectrometry

    • Surface plasmon resonance (SPR) with purified recombinant nuoK and candidate plant molecules

  • Structural biology techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify binding-induced conformational changes

    • NMR-based fragment screening with isotope-labeled nuoK and plant compound libraries

    • X-ray crystallography or cryo-EM of nuoK in complex with plant-derived ligands

  • Functional assays:

    • Enzyme kinetics in the presence of plant compounds to detect competitive or allosteric effects

    • Membrane potential measurements in bacterial cells treated with plant extracts

    • Oxygen consumption assays with isolated membrane vesicles containing wild-type or mutant nuoK

  • In vivo approaches:

    • Transcriptional fusions to monitor nuoK expression in response to plant compounds

    • Fluorescence-based interaction assays in living bacteria during plant infection

    • Metabolomic profiling to identify plant compounds modified by bacterial activity

When implementing these methods, researchers should be particularly aware of the challenges in distinguishing direct nuoK interactions from indirect effects mediated through other components of the respiratory chain. Control experiments should include parallel analysis of other membrane proteins and respiratory complexes to establish specificity.

Recent applications of these approaches have identified specific plant-derived napthoquinones that appear to interact directly with the nuoK subunit, potentially interfering with quinone binding. Interestingly, resistant P. syringae strains show amino acid substitutions in the predicted quinone-binding pocket of nuoK that reduce binding affinity for these inhibitory compounds while maintaining normal catalytic function .

How does the nuoK subunit of P. syringae compare with homologous proteins in other bacterial pathogens?

Comparative analysis of the nuoK subunit across bacterial pathogens reveals important evolutionary patterns that provide insights into functional specialization and adaptation to different hosts. The nuoK protein is highly conserved among Proteobacteria but shows interesting variations that may reflect adaptation to specific ecological niches and pathogenic lifestyles.

Sequence alignment of nuoK proteins from multiple bacterial pathogens reveals:

Bacterial SpeciesSequence Identity with P. syringae nuoKKey DifferencesAssociated Host Range
P. aeruginosa76%Higher hydrophobicity in TM2Broad (plants, animals, humans)
P. fluorescens81%Conservative substitutionsPlant growth-promoting
R. solanacearum68%Distinct charged residues in proton channelSolanaceous plants
E. coli52%Extended loop between TM2-TM3Human/animal intestinal
X. campestris59%Additional Cys residuesCruciferous plants

Structural comparison through homology modeling shows that nuoK from plant-associated bacteria (P. syringae, X. campestris) contains a more constricted quinone-binding region compared to human pathogens like P. aeruginosa. This structural difference may influence substrate specificity, with plant pathogens potentially better adapted to utilize plant-derived quinones encountered during infection .

What differences in experimental design might explain contradictory findings regarding nuoK function across studies?

Several key experimental design factors have been identified that may contribute to contradictory findings:

  • Genetic background and strain selection:

    • Studies using different P. syringae pathovars (pv. syringae vs. pv. tomato) often report divergent phenotypes for nuoK mutations

    • Laboratory-adapted strains versus recent clinical isolates may show different dependence on nuoK function

    • The presence of compensatory mutations or alternative respiratory pathways varies across strains

  • Expression systems and protein preparation:

    • Recombinant nuoK produced in E. coli versus native P. syringae may have different post-translational modifications

    • Detergent selection dramatically influences protein stability and functional assays

    • Studies using isolated nuoK versus the complete NADH-quinone oxidoreductase complex measure different functional parameters

  • Assay conditions and environmental context:

    • Temperature, pH, and ion concentrations significantly affect nuoK activity measurements

    • Oxygen tension during experiments influences respiratory chain function and alternative pathway utilization

    • Growth phase of bacterial cultures determines respiratory chain composition and activity

  • Host systems and infection models:

    • Different plant species and even different tissues within the same plant provide distinct microenvironments

    • Whole plant versus cell culture models may not recapitulate the same host-pathogen interactions

    • Timing of measurements during infection can capture different phases of pathogen adaptation

Recent meta-analyses of published nuoK studies highlight the importance of standardized reporting of experimental conditions. For example, a comparative study of nuoK function across three laboratories using supposedly identical protocols revealed that subtle differences in media preparation (specifically trace metal composition) significantly influenced respiratory chain composition and subsequent nuoK-dependent phenotypes .

These observations underscore the necessity of comprehensive experimental reporting and careful consideration of contextual factors when interpreting results related to nuoK function and its role in P. syringae biology.

How can researchers apply systems biology approaches to better understand nuoK's role in the broader context of P. syringae metabolism?

Systems biology approaches offer powerful frameworks for understanding nuoK's function within the complex metabolic and regulatory networks of P. syringae. These holistic methods can reveal emergent properties not evident from reductionist studies of isolated components.

To effectively implement systems biology for nuoK research, the following methodological framework is recommended:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and nuoK mutant strains

    • Develop condition-specific metabolic models incorporating respiratory chain components

    • Apply flux balance analysis to predict metabolic adaptations to nuoK disruption

    • Use correlation network analysis to identify genes co-regulated with nuoK under different conditions

  • Genome-scale interaction mapping:

    • Perform synthetic genetic array analysis to identify genetic interactions with nuoK

    • Apply protein-protein interaction screens to map the nuoK interactome beyond known Complex I components

    • Use chromatin immunoprecipitation to identify transcription factors regulating nuoK expression

    • Develop high-throughput phenotyping of nuoK variant libraries across environmental conditions

  • Computational modeling approaches:

    • Develop kinetic models of electron transport incorporating nuoK function

    • Use molecular dynamics simulations to understand conformational dynamics of nuoK during catalysis

    • Implement machine learning approaches to predict nuoK function from sequence variation across strains

    • Apply evolutionary models to reconstruct the adaptive history of nuoK in plant pathogens

  • Integration with host response data:

    • Correlate plant transcriptomic responses with bacterial respiratory chain activity

    • Model metabolic exchanges between host and pathogen, focusing on compounds interacting with nuoK

    • Develop multi-scale models that connect molecular events at the nuoK level to cellular and organism-level phenotypes

Recent applications of these approaches have yielded several important insights. For example, metabolic flux analysis comparing wild-type and nuoK mutant strains revealed unexpected rerouting of carbon flux through the pentose phosphate pathway when NADH-quinone oxidoreductase function is compromised. This metabolic adaptation appears to partially compensate for energy deficits by generating NADPH and precursors for nucleotide synthesis, potentially contributing to bacterial survival despite respiratory chain impairment .

Additionally, comparative genomic analysis across 120 P. syringae isolates identified specific single nucleotide polymorphisms in nuoK that correlate with host range specialization, suggesting that subtle variations in respiratory chain function may contribute to host adaptation strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.