Recombinant Pseudomonas syringae pv. syringae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Properties of Recombinant ArnE

PropertyValue/DescriptionSource
Gene NamearnE
Protein Length108 amino acids (Full-length)
Molecular Weight~12.1 kDa (His-tagged)
Expression HostE. coli
FunctionTransmembrane transport of α-L-Ara4N-phosphoundecaprenol

Genetic and Biochemical Characteristics

ArnE belongs to the drug/metabolite transporter (DMT) superfamily and forms a heterodimer with ArnF . Deletion of arnE restores polymyxin sensitivity in resistant Salmonella strains, highlighting its role in lipid A modification and antibiotic resistance .

Table 2: ArnE and ArnF Subunit Comparison

FeatureArnEArnF
Amino Acids108144
Molecular Weight~12.1 kDa~16.5 kDa
Uniprot IDQ4ZSY9 (P. syringae)Q4ZSY8 (P. syringae)
Role in FlippaseSubunit for substrate binding/transportSubunit for exonuclease activity?

Data synthesized from

Role in Bacterial Pathogenicity and Lipid A Modification

ArnE is essential for modifying lipid A, a component of lipopolysaccharide (LPS), which is critical for bacterial membrane integrity and evasion of host immune responses . In Pseudomonas syringae, lipid A modifications confer resistance to antimicrobial peptides like polymyxin .

Key Findings:

  1. Antibiotic Resistance: Deletion of arnE or arnF in polymyxin-resistant bacteria restores sensitivity, underscoring their role in lipid A modification .

  2. Structural Homology: ArnE and ArnF exhibit homology to phage-encoded recombinases (RecT/RecE), suggesting evolutionary conservation in membrane transport mechanisms .

  3. Heterodimer Formation: ArnE and ArnF likely act as a heterodimer, with ArnE facilitating substrate recognition and ArnF enabling enzymatic activity .

Research Applications and Biochemical Studies

The recombinant His-tagged ArnE protein is used in:

  • Structural Biology: Crystallization studies to elucidate flippase architecture .

  • Enzyme Assays: In vitro reconstitution of α-L-Ara4N-phosphoundecaprenol transport .

  • Pathogenicity Models: Investigating lipid A modification in Pseudomonas spp. and its impact on host-pathogen interactions .

Comparative Analysis with Other Flippase Subunits

ArnE’s function contrasts with other flippases, such as PmrL/PmrM in Salmonella, which also mediate lipid A modification but exhibit distinct substrate specificities .

OrganismFlippase SubunitsSubstrate
Pseudomonas syringaeArnE/ArnFα-L-Ara4N-phosphoundecaprenol
SalmonellaPmrL/PmrML-Ara4N-phosphoundecaprenol

Challenges and Future Directions

  1. Structural Elucidation: High-resolution structures of ArnE/ArnF complexes are needed to map substrate binding sites .

  2. Phylogenetic Diversity: ArnE homologs in other Pseudomonas species may reveal strain-specific lipid A modification strategies .

  3. Therapeutic Targeting: Inhibiting ArnE/ArnF could disrupt bacterial membrane stability, offering novel antimicrobial approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
arnE; Psyr_2694; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
arnE
Target Protein Sequence
MLASACLLTCLGQIAQKYAVQGWRGAFPGVFAALRSLWLALACLGSGLLIWLLVLQRLDV GIAYPMLGVNFVLITLAGRYVFNEPVDVRHWLGIALILVGVFQLGRQA
Uniprot No.

Target Background

Function
This protein functions as a flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ArnE and what is its role in Pseudomonas syringae?

ArnE functions as a subunit of a lipid flippase involved in the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across cellular membranes in Pseudomonas syringae. Lipid flippases are integral membrane proteins that facilitate the bidirectional movement of lipid molecules between membrane leaflets, maintaining membrane asymmetry and facilitating various cellular processes. In bacteria like P. syringae, lipid flippases play crucial roles in stress responses, particularly in relation to environmental challenges and host interactions. While specific research on ArnE in P. syringae is limited, studies on related flippases in plants suggest potential roles in viral defense, temperature adaptation, and nutrient uptake under stress conditions . The molecular mechanism likely involves ATP-dependent conformational changes that enable substrate translocation across the lipid bilayer, similar to other P4-ATPase lipid flippases.

What recombineering techniques are available for working with P. syringae genes like arnE?

Recombineering techniques for P. syringae have been developed based on the RecET system originally identified in P. syringae pv. syringae B728a. These techniques allow for precise genetic manipulation and targeted gene disruptions through homologous recombination. The RecT protein from P. syringae is sufficient to promote recombination of single-stranded DNA oligonucleotides, while efficient recombination of double-stranded DNA requires expression of both RecT and RecE homologs . For working with genes like arnE, researchers can employ these systems using the following approach:

  • Construct expression vectors containing RecT alone or RecTE proteins under control of appropriate promoters

  • Introduce these vectors into P. syringae pv. tomato DC3000 or other strains

  • Design linear DNA substrates with homology arms flanking the arnE target region

  • Electroporate the linear DNA into RecT/RecTE-expressing cells

  • Select recombinants using appropriate markers

The system has been optimized using vectors like pUCP24/47 containing the P. syringae RecT (recTPsy) and RecTE genes, which can later be eliminated using counterselection with the Bacillus subtilis sacB gene .

What are the basic structural features of lipid flippases like ArnE?

While the specific structure of P. syringae ArnE has not been fully characterized, insights can be drawn from related P4-ATPase lipid flippases. These proteins typically contain multiple transmembrane domains arranged to form a transport pathway across the membrane. Recent cryo-EM studies of the Drs2p-Cdc50p complex, a eukaryotic P4-ATPase lipid flippase, have revealed important structural features including autoregulatory domains and conformational states during the transport cycle .

P4-ATPase lipid flippases generally operate through an ATP-dependent cycle involving several conformational states (E1, E1P, E2P, and E2), with substrate binding and release coupled to ATP hydrolysis. The protein contains catalytic domains (actuator, nucleotide-binding, and phosphorylation domains) that coordinate ATP binding and hydrolysis with substrate transport. The transmembrane region typically forms a pathway that allows lipid head groups to pass through the protein while keeping the hydrophobic tails within the membrane environment.

How should researchers design experiments to functionally characterize ArnE in P. syringae?

Functional characterization of ArnE requires a multifaceted approach combining genetic, biochemical, and biophysical techniques. A comprehensive experimental design should include:

  • Genetic analysis:

    • Generate precise gene knockouts using RecTE-mediated recombineering in P. syringae

    • Create point mutations in key functional residues

    • Complement mutants with wild-type and modified arnE variants

  • Expression and purification:

    • Optimize recombinant expression conditions (temperature, induction time, media composition)

    • Design constructs with various affinity tags (His, FLAG, Strep) at N- or C-terminus

    • Test detergent solubilization conditions (LMNG has been successful for other flippases )

    • Implement size-exclusion chromatography to ensure sample homogeneity

  • Functional assays:

    • Develop in vitro lipid translocation assays using fluorescent lipid analogs

    • Measure ATPase activity and establish its coupling to lipid transport

    • Perform temperature-dependent activity measurements to assess thermostability

  • Phenotypic characterization:

    • Assess stress tolerance (temperature, antimicrobials, pH)

    • Evaluate membrane integrity under various conditions

    • Analyze lipid composition changes in arnE mutants

Researchers should establish clear quantitative metrics for each assay and include appropriate controls, such as catalytically inactive mutants and related flippase proteins.

What are the potential pleiotropic effects of modifying arnE expression in P. syringae?

Based on studies of lipid flippases in other systems, modifications to arnE expression could lead to numerous pleiotropic effects due to the central role of membrane lipid organization in cellular processes. Plant P4-ATPases like ALA1, ALA3, and ALA10 demonstrate multiple functions affecting diverse cellular processes . By analogy, ArnE in P. syringae might influence:

  • Stress responses: Modified arnE expression could alter temperature tolerance. ALA3 and ALA10 in plants show temperature-dependent phenotypes, with mutants exhibiting growth defects at both low and high temperatures . ArnE modification might similarly affect P. syringae's temperature adaptation.

  • Host-pathogen interactions: Altered flippase activity could impact the trafficking of virulence factors or defense-related proteins. In plants, ALA3 affects the trafficking of the defense-related ABC-transporter PEN3 , suggesting ArnE might influence similar defense-related trafficking in P. syringae.

  • Nutrient acquisition: Changes in membrane composition due to altered flippase activity could affect nutrient transporters' function. Plant ala3 mutants show growth defects dependent on nutritional conditions, likely due to defective trafficking of membrane transporters .

  • Antimicrobial resistance: Modifications to lipid distribution in the membrane could alter susceptibility to antimicrobial compounds by changing membrane permeability or efflux pump function.

Researchers should employ global approaches like transcriptomics, proteomics, and lipidomics to fully characterize these potential pleiotropic effects when modifying arnE expression.

How can protein-protein interaction analysis be applied to study ArnE function?

  • Computational prediction methods:

    • Deep learning approaches using self-supervision can efficiently utilize annotated and unannotated biological data to predict protein-protein interactions (PPIs)

    • AlphaFold-based structural modeling can provide atomistic models of ArnE interacting with potential partner proteins

    • Language models trained on protein sequences can identify both permanent and transient PPIs

  • Experimental validation techniques:

    • Co-immunoprecipitation followed by mass spectrometry to identify ArnE interactors

    • Bacterial two-hybrid or split-protein complementation assays

    • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) for in vivo interaction studies

    • Crosslinking mass spectrometry to map interaction interfaces

  • Functional validation:

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with peptides derived from interaction domains

    • Co-expression studies assessing functional outcomes of disrupted interactions

This combined approach can reveal both structural components that might form stable complexes with ArnE and transient regulatory interactions that modulate its activity in response to environmental conditions.

What structural information can be inferred about ArnE based on related flippases?

While direct structural data for P. syringae ArnE is limited, valuable insights can be derived from studies of related flippases:

Structural FeatureDescriptionRelevance to ArnE
Transmembrane domainsTypically 10 transmembrane helices forming the transport pathwayLikely conserved in ArnE, creating the substrate transport channel
Nucleotide-binding domainCytoplasmic domain binding ATPExpected to be present in ArnE to power transport
Phosphorylation domainSite of catalytic aspartate phosphorylationCritical for ATPase cycle in P4-ATPases including ArnE
Actuator domainMediates dephosphorylationLikely present in ArnE with conserved TGES motif
Regulatory C-terminusAutoregulatory region in some flippasesMay be present in ArnE as a regulatory element
Accessory subunitsBeta-subunits (like Cdc50) in some flippasesUnknown if ArnE requires accessory subunits

Recent cryo-EM structures of the Drs2p-Cdc50p complex have revealed the conformational states from fully autoinhibited (E2Pinhib) to activated outward-open conformations . These structures show how the C-terminal regulatory domain can block the substrate-binding site in the inhibited state, and how activators like phosphatidylinositol 4-phosphate (PI4P) can relieve this inhibition. ArnE may employ similar regulatory mechanisms, though the specific activators would likely differ in bacterial systems.

What is the optimal protocol for recombinant expression and purification of ArnE?

Based on successful approaches with related membrane proteins, the following protocol is recommended for recombinant expression and purification of ArnE from P. syringae:

  • Construct design:

    • Clone the arnE gene into an expression vector with an N- or C-terminal affinity tag

    • Consider using a strong but controllable promoter system

    • Include a protease cleavage site between the tag and protein for tag removal

  • Expression conditions:

    • Transform the construct into an appropriate P. syringae strain or E. coli

    • For homologous expression, use the RecTE system for chromosomal integration

    • Grow cells at 25-30°C to mid-log phase before induction

    • For membrane proteins, lower induction temperatures (16-20°C) often improve folding

    • Harvest cells after 4-16 hours of induction

  • Membrane preparation:

    • Disrupt cells by sonication or high-pressure homogenization

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membranes by ultracentrifugation at 100,000 × g for 1 hour

    • Wash membranes to remove peripheral proteins

  • Solubilization and purification:

    • Solubilize membranes using detergents like LMNG, which has proven effective for other flippases

    • Perform affinity chromatography using the engineered tag

    • Further purify by size-exclusion chromatography to ensure homogeneity

    • Consider adding lipids during purification to maintain protein stability

  • Quality control:

    • Assess purity by SDS-PAGE and Western blotting

    • Verify protein identity by mass spectrometry

    • Evaluate aggregation state by dynamic light scattering

    • Test ATPase activity to confirm functional integrity

This protocol should yield purified, functional ArnE suitable for biochemical and structural studies.

How can researchers effectively use recombineering for targeted modification of arnE?

For targeted modification of the arnE gene in P. syringae using recombineering techniques, researchers should follow this optimized protocol based on the RecTE system:

  • Prepare RecTE expression system:

    • Transform P. syringae with a plasmid expressing RecT alone (for ssDNA recombination) or RecTE (for dsDNA recombination)

    • The plasmid pUCP24/47 containing P. syringae RecT (recTPsy) and RecTE genes has been validated for this purpose

    • Culture cells containing the RecTE expression vector under appropriate selection

  • Design recombination substrates:

    • For point mutations: Design 60-80 nucleotide single-stranded oligonucleotides with the mutation centered in the sequence

    • For gene replacements/insertions: Create double-stranded DNA fragments with 50-500 bp homology arms flanking the target site

    • Include selectable markers for screening recombinants

  • Perform recombineering:

    • Grow cells expressing RecTE to mid-log phase

    • Prepare electrocompetent cells by washing with 10% glycerol

    • Electroporate DNA substrates into cells (typically 100 ng for oligonucleotides, 500 ng for dsDNA)

    • Allow recovery in non-selective media for 2-4 hours

    • Plate on selective media to isolate recombinants

  • Verify recombinants:

    • Screen colonies by PCR to identify successful recombinants

    • Confirm modifications by sequencing

    • Eliminate the RecTE expression vector using counterselection with the sacB gene

  • Functional validation:

    • Confirm expression of modified ArnE by Western blotting

    • Perform phenotypic assays to assess the impact of modifications

This protocol enables precise genetic manipulation of arnE without introducing unwanted mutations or leaving behind large selection markers, facilitating detailed structure-function studies.

What approaches are recommended for analyzing ArnE-mediated lipid translocation?

Analyzing the lipid translocation activity of ArnE requires specialized assays that can detect the movement of lipids across membranes. The following approaches are recommended:

  • Fluorescence-based assays:

    • Reconstitute purified ArnE into liposomes containing fluorescently labeled lipid analogs

    • Monitor fluorescence changes upon lipid translocation using stopped-flow spectrometry

    • Use fluorescence quenching or FRET-based methods to detect lipid movement

  • Biochemical assays:

    • Employ lipid extraction and thin-layer chromatography to quantify lipid distribution

    • Use mass spectrometry to analyze lipid composition changes in different membrane leaflets

    • Develop enzymatic assays that detect substrates specifically on one membrane side

  • Biophysical approaches:

    • Measure ATPase activity as a proxy for transport function

    • Use surface plasmon resonance to study lipid binding

    • Apply solid-state NMR to monitor lipid dynamics in reconstituted systems

  • Cellular assays:

    • Create fluorescent lipid probes that report on membrane asymmetry

    • Develop growth-based selection systems where cell survival depends on ArnE function

    • Use flow cytometry to quantify changes in membrane properties

Researchers should establish clear substrate specificity profiles for ArnE by testing various lipid types, including the native substrate 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol as well as other phospholipids and glycolipids.

How should researchers interpret conflicting data in ArnE functional studies?

When faced with conflicting data in ArnE functional studies, researchers should implement a systematic approach to resolve discrepancies:

  • Methodological evaluation:

    • Compare experimental conditions, including expression systems, purification methods, and assay conditions

    • Assess the integrity and purity of protein preparations

    • Evaluate the sensitivity and specificity of detection methods

    • Consider the impact of tags, fusion partners, or mutations on protein function

  • Contextual differences:

    • Analyze strain-specific effects that might influence ArnE function

    • Consider environmental factors (temperature, pH, ionic strength) that could affect activity

    • Evaluate the lipid composition of membranes used in functional assays

  • Regulatory mechanisms:

    • Investigate potential autoregulatory mechanisms similar to those observed in other flippases

    • Consider the presence or absence of regulatory binding partners or activators

    • Examine post-translational modifications that might modulate activity

  • Biological redundancy:

    • Assess whether other flippases might compensate for ArnE function

    • Investigate potential synthetic phenotypes with related genes

    • Consider context-dependent functional specificity

  • Technical approaches to resolve conflicts:

    • Implement orthogonal experimental methods to validate findings

    • Perform dose-response experiments to identify threshold effects

    • Use genetic complementation to confirm phenotype-genotype relationships

    • Apply statistical methods to assess reproducibility and significance

Researchers studying plant P4-ATPases have noted context-dependent functions for proteins like ALA10, which shows different phenotypes under varying conditions such as temperature stress, phosphate starvation, and viral exposure . Similar context-dependent functions may explain conflicting results in ArnE studies.

What bioinformatic approaches are most effective for analyzing ArnE structure and function?

Modern bioinformatic approaches provide powerful tools for predicting and analyzing ArnE structure and function:

  • Sequence analysis:

    • Multiple sequence alignment to identify conserved motifs and functional residues

    • Phylogenetic analysis to understand evolutionary relationships with other flippases

    • Transmembrane topology prediction to map membrane-spanning regions

  • Structure prediction:

    • AlphaFold or RoseTTAFold for predicting protein structure

    • Contact-based modeling approaches, which have proven effective for repeat proteins

    • Molecular dynamics simulations to study conformational dynamics

  • Functional prediction:

    • Prediction of post-translational modification sites

    • Identification of potential lipid-binding sites

    • Substrate specificity prediction based on binding pocket analysis

  • Protein-protein interaction prediction:

    • Deep learning methods like those described by Elofsson can identify potential interaction partners

    • Coevolution analysis to detect residue pairs involved in protein-protein interactions

    • Docking simulations to model complex formation

  • Experimental data integration:

    • Incorporation of cross-linking mass spectrometry data into structural models

    • Integration of mutagenesis data to refine functional predictions

    • Mapping of evolutionary conservation onto structural models

These approaches should be used in combination to develop comprehensive models of ArnE structure and function, guiding experimental design and interpretation.

What emerging technologies might advance our understanding of ArnE function?

Several cutting-edge technologies show promise for advancing ArnE research:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have enabled structure determination of membrane proteins like the P4-ATPase lipid flippase Drs2p-Cdc50p . Similar approaches could reveal the structural basis of ArnE function and regulation.

  • Single-molecule techniques: Methods like single-molecule FRET can track individual transport cycles, providing insights into transport kinetics and conformational changes not accessible through bulk measurements.

  • Native mass spectrometry: This technique can analyze intact membrane protein complexes, helping identify interaction partners and regulatory molecules that modulate ArnE function.

  • AI-based structure and function prediction: Deep learning approaches for protein structure prediction and protein-protein interaction analysis continue to advance rapidly and will provide increasingly accurate models of ArnE structure and functional networks .

  • Genome editing technologies: Further refinement of recombineering techniques in P. syringae will facilitate more precise genetic manipulation for functional studies .

  • High-throughput phenotyping: Automated systems for measuring bacterial growth and stress responses under various conditions can help characterize the pleiotropic effects of ArnE modifications.

  • In situ structural biology: Techniques like cryo-electron tomography could eventually allow visualization of ArnE in its native membrane environment, revealing physiologically relevant arrangements and interactions.

These technologies, especially when used in combination, promise to provide unprecedented insights into the molecular mechanisms of ArnE function and its role in P. syringae physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.