Recombinant Pseudomonas syringae pv. syringae Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Protein Overview

ArnF is a subunit of the ArnEF flippase complex responsible for translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner bacterial membrane . This modification enables gram-negative bacteria like Pseudomonas syringae to resist cationic antimicrobial peptides (CAMPs) by altering the charge of lipopolysaccharides (LPS) in their outer membrane .

PropertyDescription
OrganismPseudomonas syringae pv. syringae
UniProt IDQ4ZSY8
Amino Acid Range1–144 aa
TagN-terminal His tag
Expression SystemEscherichia coli
Molecular FunctionUndecaprenyl phosphate-α-L-Ara4N flippase activity
Biological ProcessLipid A modification, antimicrobial resistance

Recombinant Production and Applications

The recombinant ArnF protein is commercially produced for biochemical and structural studies:

3.2. Experimental Utility

  • Antimicrobial Resistance Studies: Used to dissect mechanisms of polymyxin resistance in Pseudomonas pathogens .

  • Protein-Protein Interaction Assays: Facilitates analysis of ArnEF complex stability and partner binding .

4.1. Functional Insights

  • Lipid A Modification: ArnF-deficient strains show impaired L-Ara4N incorporation into lipid A, increasing susceptibility to polymyxins .

  • Conservation Across Species: Homologs of ArnF exist in Salmonella (e.g., PmrM) and E. coli, underscoring its evolutionary importance .

Functional DesignationHomolog in SalmonellaHomolog in E. coli
ArnFPmrMb2258

4.2. Pathogenicity Link

While ArnF is not directly a virulence factor, its role in evading host innate immunity via LPS modification indirectly supports P. syringae survival in plant hosts .

Future Directions

Current research leverages recombinant ArnF to:

  • Develop inhibitors targeting the ArnEF flippase to restore antibiotic efficacy .

  • Engineer plant-associated microbes with altered LPS for agricultural applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
arnF; Psyr_2695; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
arnF
Target Protein Sequence
MTHRRATLCAMASVALVSAAQLGMRWSMSRLPSPVQWLEMQEHAQLDLSALRVVCASITA YALSMLFWLLALRVLPLSRAYSLLSISYALVYTLAATLPFFHETFTVSKTVGVSLIVAGV LTINLRRLPRPSPQDLSHENQRFR
Uniprot No.

Target Background

Function
This protein functions as a flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the main types of bacteriocins produced by Pseudomonas syringae?

Pseudomonas syringae produces several types of bacteriocins, but the dominant killing activity across strains is from high molecular weight phage tail-derived bacteriocins known as R-type syringacins. These compounds are inducible by DNA-damaging agents and can be selectively precipitated using polyethylene glycol (PEG). R-type syringacins typically produce crisp borders in agar overlay assays, which distinguishes them from other antimicrobial compounds. The prevalence of R-type syringacins across approximately 68% of tested strains suggests they play a critical role in structuring microbial communities of P. syringae .

How can R-type syringacins be isolated and characterized from Pseudomonas syringae cultures?

R-type syringacins can be isolated through a methodical process that begins with inducing bacteriocin production using DNA-damaging agents such as mitomycin C. After induction, the bacteriocins can be precipitated from culture supernatants using polyethylene glycol (PEG), which selectively concentrates high molecular weight compounds. Characterization of killing activity can be performed using agar overlay assays, where the producer strain is spotted onto a lawn of potential target strains. A clear zone of inhibition with crisp borders indicates R-type syringacin activity. For more precise molecular characterization, genome sequencing can identify the genes encoding the structural components of the R-type syringacin, with particular attention to the receptor-binding protein (Rbp) and its chaperone, which determine targeting specificity .

What patterns of bacteriocin sensitivity and resistance exist across Pseudomonas syringae strains?

Research across diverse P. syringae strains reveals that both killing spectra and sensitivity to R-type syringacins can be broadly classified into main groups. For the strains assayed, killing spectra typically fall into two main clusters (1 and 2), while sensitivity patterns also form two distinct groups (A and B). Membership in these clusters is highly correlated: strains in killing cluster 1 typically belong to sensitivity cluster B and target strains from cluster A, while strains in killing cluster 2 typically belong to sensitivity cluster A and target strains from cluster B. There are exceptions to these patterns, including strains with mixed killing profiles and strains that are resistant to their own R-type syringacin while remaining sensitive to other tailocins from the same killing group. These patterns differ from previously reported groupings, potentially due to differences in clustering methodology and focus on R-type syringacin-mediated killing rather than broader bacteriocin activity .

How does localized recombination influence bacteriocin targeting specificity in Pseudomonas syringae?

Localized recombination plays a crucial role in diversifying the killing spectra of R-type syringacins in P. syringae. Comparative genomic analysis reveals that while phylogenies built from sequences of most syringacin structural genes are consistent with vertical inheritance and match phylogroups assigned based on housekeeping genes, phylogenies built from receptor-binding protein (Rbp) sequences display extensive differences. These Rbp phylogenies form two clear clades that correspond to distinct killing activity groups, suggesting that Rbps frequently undergo horizontal gene transfer between strains.

Detailed nucleotide diversity mapping across genomic regions involving these genes shows that recombination events are highly localized. For example, in three independent pairwise comparisons between closely related strains with different killing spectra, the N-terminus of the Rbp is relatively highly conserved and likely serves as an anchor point for recombination. The recombination breakpoints appear to occur at different positions downstream of the Rbp and chaperone genes but typically upstream of a lysozyme-like protein that is vertically inherited. This pattern of clean replacement of both the Rbp and chaperone genes through recombination strongly correlates with complete changes in killing spectra, highlighting how targeted genetic exchange can rapidly alter strain interactions .

What experimental approaches can verify the function of recombinant proteins in redirecting bacteriocin targeting?

To verify that specific recombinant proteins can redirect bacteriocin targeting, researchers can employ complementation studies using mutant strains. A methodological approach demonstrated in the literature involves:

  • Creating a deletion mutant lacking the genes of interest (e.g., receptor-binding protein and chaperone)

  • Constructing an expression vector containing orthologous genes from a strain with different targeting specificity

  • Introducing this vector into the deletion mutant

  • Assessing changes in bacteriocin killing spectrum

For example, researchers successfully complemented a P. syringae pv. syringae B728a strain lacking its native Rbp and chaperone with the corresponding genes from P. syringae pv. japonica. The experimental procedure involved:

  • Amplifying the Rbp and chaperone genes from genomic DNA of the donor strain

  • Recombining these genes into an expression vector (pBAV226) using gateway cloning

  • Introducing the resulting plasmid into the deletion mutant through conjugation

  • Testing killing activity using agar overlay assays against various target strains

This approach confirmed that horizontal transfer of just the Rbp and chaperone genes is sufficient to retarget the bacteriocin's killing spectrum, with the complemented strain exhibiting a killing profile matching the donor strain rather than its original profile .

What mechanisms could explain the high frequency of recombination observed in bacteriocin targeting genes?

The high frequency of recombination observed specifically in the receptor-binding protein (Rbp) and chaperone genes of P. syringae syringacins presents a mechanistic puzzle. Traditional horizontal gene transfer mechanisms in P. syringae (phage transduction or conjugation) do not easily explain the highly site-specific nature of these recombination events. Several possible mechanisms have been proposed:

  • Natural transformation: Localized recombination with clean replacement of existing alleles could occur through uptake of extracellular DNA followed by homologous recombination. Although P. syringae is typically recalcitrant to transformation under laboratory conditions, natural transformation has been reported in planta. The specific signals triggering competence remain undefined.

  • Vesicle-mediated transfer: Transformation might be facilitated through production of membrane vesicles containing DNA.

  • Phage-mediated exchange: An intriguing hypothesis suggests that the exchange could be phage-mediated, not through general or special transduction, but because the Rbp/chaperone pairs are shared with extant phages. In this model, phages (likely Myoviridae) would utilize the same Rbp/chaperone to infect P. syringae hosts, and upon infection, recombine with the R-type syringacin locus rather than completing a lytic cycle or establishing lysogeny.

The promiscuity of phages isolated from phyllosphere environments, including those able to infect P. syringae, makes the phage-mediated exchange hypothesis particularly compelling, though further research is needed to determine the exact mechanism .

How can we experimentally distinguish between different modes of horizontal gene transfer in bacteriocin gene acquisition?

To experimentally distinguish between different modes of horizontal gene transfer (HGT) in bacteriocin gene acquisition, researchers can implement a multi-faceted approach:

For natural transformation:

  • Test competence development under various environmental conditions (plant extracts, stress conditions)

  • Quantify uptake of labeled DNA containing Rbp/chaperone genes

  • Assess recombination frequency in strains with mutations in natural competence genes

For phage-mediated exchange:

  • Isolate phages from environments where P. syringae strains coexist

  • Sequence phage genomes to identify shared Rbp/chaperone genes

  • Track phage infection and potential recombination events using fluorescently labeled phages

  • Monitor single-strand DNA production from R-type syringacin loci

For vesicle-mediated transfer:

  • Isolate membrane vesicles and characterize their DNA content

  • Test whether vesicles containing Rbp/chaperone genes can mediate gene transfer

Comparative approaches:

  • Monitor recombination frequencies in the presence of DNase (to eliminate transformation)

  • Compare recombination patterns in natural isolates versus laboratory conditions

  • Use bioinformatic analyses to detect signatures of different HGT mechanisms

By implementing these methodologies and comparing their results, researchers can build a more complete understanding of the predominant mechanisms driving the observed pattern of localized recombination in bacteriocin targeting genes .

What considerations are important when designing experiments to study bacteriocin-mediated interactions in plant environments?

When designing experiments to study bacteriocin-mediated interactions of P. syringae in plant environments, researchers should consider several key factors:

Environmental variables:

  • Temperature fluctuations that might affect bacteriocin production and stability

  • Humidity levels that influence bacterial population density

  • Plant developmental stage and immune status

  • Presence of other microorganisms that might interact with P. syringae

Experimental controls:

  • Inclusion of bacteriocin-deficient mutants to confirm bacteriocin-mediated effects

  • Use of purified bacteriocins versus producer strains to distinguish direct from indirect effects

  • Assessment of plant responses to ensure observed effects are not due to plant immunity

Methodological approaches:

  • In planta versus in vitro assays to account for plant environment effects

  • Time-course experiments to capture dynamics of interactions

  • Spatial resolution techniques to map bacteriocin activity on plant surfaces

  • Combination of culture-dependent and -independent methods to assess community responses

Analytical considerations:

  • Statistical power calculations to determine appropriate sample sizes

  • Accounting for spatial heterogeneity in microbial distributions on plant surfaces

  • Distinguishing bacteriocin effects from other competitive mechanisms

By carefully addressing these considerations, researchers can design robust experiments that accurately capture the ecological significance of bacteriocin-mediated interactions in the plant environment .

How can genome editing approaches be used to investigate the functional domains of bacteriocin targeting proteins?

Genome editing approaches offer powerful tools for investigating the functional domains of bacteriocin targeting proteins in P. syringae. A comprehensive strategy would include:

CRISPR-Cas9 methodologies:

  • Creating precise deletions of specific domains within the Rbp

  • Generating domain swaps between Rbps with different specificities

  • Introducing point mutations at conserved residues to assess their importance

Domain mapping strategies:

  • Sequential truncation of the Rbp to identify minimal regions required for binding

  • Creation of chimeric proteins combining domains from Rbps with different specificities

  • Site-directed mutagenesis of predicted binding interfaces

Functional verification approaches:

  • Bacteriocin killing assays using mutant producer strains

  • Direct binding assays using purified Rbp variants

  • Structural biology approaches (X-ray crystallography, cryo-EM) to visualize Rbp interactions

In vivo validation:

  • Complementation studies expressing modified Rbps in Rbp-deletion backgrounds

  • Competition assays between strains expressing different Rbp variants

  • In planta studies to assess ecological relevance of domain functions

By systematically applying these genome editing approaches, researchers can define the structural basis for bacteriocin targeting specificity, potentially enabling rational design of bacteriocins with novel targeting capabilities .

What statistical approaches are most appropriate for analyzing bacteriocin sensitivity patterns across strain collections?

Analyzing bacteriocin sensitivity patterns across strain collections requires robust statistical approaches that can handle complex interaction data. Recommended methodologies include:

For initial pattern identification:

  • Hierarchical clustering to identify groups of strains with similar killing or sensitivity profiles

  • Principal Component Analysis (PCA) to reduce dimensionality and identify major patterns

  • Heatmap visualization with dendrograms to represent killing matrices

For correlation with genetic features:

  • Mantel tests to compare distances in killing phenotypes versus genetic distances

  • Phylogenetic comparative methods to account for shared evolutionary history

  • Association studies linking specific genetic variants to killing phenotypes

For predictive modeling:

  • Machine learning approaches (random forests, support vector machines) to predict killing spectra based on genetic features

  • Cross-validation to assess predictive power of models

For ecological interpretation:

  • Network analysis to map strain interactions and identify keystone antagonists

  • Null models to test whether observed interaction patterns differ from random expectations

  • Diversity metrics to quantify the breadth of killing activity across strains

When applying these approaches, researchers should consider the non-independence of strains due to shared evolutionary history and implement appropriate corrections, such as phylogenetically independent contrasts or mixed models with phylogenetic covariance structures .

How can contradictions between phylogenetic and functional data be reconciled when studying bacteriocin evolution?

Contradictions between phylogenetic relationships and functional characteristics of bacteriocins, as observed in P. syringae, can be reconciled through several analytical approaches:

Identifying recombination events:

  • Apply recombination detection algorithms (e.g., RDP4, ClonalFrameML) to detect breakpoints

  • Compare phylogenies built from different genes to identify incongruencies

  • Use sliding window approaches to map regions of atypical sequence similarity

Separating vertical from horizontal evolutionary signals:

  • Construct core genome phylogenies to establish baseline evolutionary relationships

  • Build gene-specific phylogenies to identify deviations from expected patterns

  • Apply reconciliation methods that model gene gain, loss, and transfer events

Temporal analyses:

  • Employ molecular clock analyses to date recombination events

  • Use ancestral state reconstruction to infer historical killing phenotypes

  • Apply Bayesian approaches to model the acquisition of new killing capabilities

Functional-structural integration:

  • Map functional differences to specific sequence changes

  • Use protein modeling to predict how sequence changes affect targeting

  • Combine population genomics with experimental validation of phenotypic effects

In the case of P. syringae bacteriocins, this integrated approach has revealed that while most of the R-type syringacin locus follows vertical inheritance patterns consistent with the core genome, the receptor-binding protein and chaperone genes follow completely different evolutionary trajectories driven by frequent horizontal gene transfer, explaining the observed contradictions between phylogeny and function .

What potential applications exist for engineered bacteriocins in agricultural disease management?

Engineered bacteriocins from P. syringae offer promising applications for agricultural disease management, with several potential strategies:

Targeted pathogen control:

  • Engineering bacteriocins with specificity toward plant pathogenic strains while sparing beneficial microbes

  • Developing cocktails of bacteriocins with complementary killing spectra to prevent resistance development

  • Creating bacteriocin-producing biocontrol strains that can establish and deliver continuous protection

Delivery systems:

  • Formulating stable bacteriocin preparations for field application

  • Developing seed coating technologies incorporating purified bacteriocins

  • Engineering plant-associated microbes to deliver bacteriocins in situ

Integration with existing management strategies:

  • Combining bacteriocins with conventional antimicrobials for enhanced efficacy

  • Using bacteriocins in resistance management programs to reduce selection pressure from traditional pesticides

  • Developing bacteriocins targeting pathogens resistant to conventional controls

Precision agriculture applications:

  • Designing diagnostic-treatment systems that detect specific pathogens and deploy targeted bacteriocins

  • Creating smart delivery systems that release bacteriocins in response to pathogen detection

  • Developing bacteriocin treatments tailored to specific crop varieties and growing conditions

The ability to retarget bacteriocins through simple genetic modifications, as demonstrated with the transfer of Rbp and chaperone genes, provides a powerful platform for developing customized biocontrol agents with specificity toward problematic pathogens .

How might comparative genomics of bacteriocin loci inform our understanding of bacterial community ecology?

Comparative genomics of bacteriocin loci can provide profound insights into bacterial community ecology, particularly for P. syringae populations:

Coevolutionary dynamics:

  • Mapping geographic patterns of bacteriocin diversity to understand local adaptation

  • Identifying coevolutionary patterns between killing capabilities and resistance mechanisms

  • Tracking temporal changes in bacteriocin gene frequencies in response to community composition

Ecological network structure:

  • Constructing interaction networks based on bacteriocin killing profiles

  • Identifying keystone antagonists that shape community composition

  • Predicting community stability based on patterns of cross-resistance and killing

Niche differentiation:

  • Assessing how bacteriocin-mediated antagonism contributes to resource partitioning

  • Analyzing bacteriocin diversity in relation to habitat characteristics

  • Determining how bacteriocin production costs influence competitive outcomes

Community assembly processes:

  • Evaluating the role of bacteriocins in priority effects during colonization

  • Assessing whether bacteriocin-mediated exclusion contributes to invasion resistance

  • Modeling how bacteriocin dynamics influence community succession

The extensive diversity in bacteriocin killing spectra, combined with the rapid evolutionary potential through localized recombination, suggests that bacteriocins may be key drivers of microbial community structure. By integrating genomic data with ecological theory, researchers can develop more comprehensive models of how these antimicrobial compounds shape natural bacterial assemblages .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.