Recombinant Pseudomonas syringae pv. syringae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; Psyr_0387; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
ubiB
Target Protein Sequence
MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWWMLALRFVLPWRWLPRRKSELSRGVRFR LALQDLGPIFIKFGQLLSTRRDLLPEDIADELMLLQDRVPPFDQQLAIKLIEEQLGARIC DVFSRFDEKPLASASVAQVHAACLKTGEEVVVKVVRPGLKPIIGQDLAWLFILARMAERV SADARLLHPVQVVMDYEKTIYDELDLLREAANASQLRRNFEGSDLLYVPQVYWDWCRPKV LVMERIYGLQVTDMAGLADQRTDMKLLAERGVEIFFTQIFRDSFFHADMHPGNIFVSTVN PWAPKYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPAETKLNEFE AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY PELDLWSTAQPYLERWMRERVSPKTLLGNLQSQVEQLPHIAGMTRDLLERMSRPHASDPP RPWHDRKDEPVLRLIGAALLVGGAIQGWVMSEAATQLLTLTAWPAAIMLIAGLYLIVRR
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UbiB protein in Pseudomonas syringae pv. syringae?

UbiB in Pseudomonas syringae pv. syringae is a probable ubiquinone biosynthesis protein that plays a critical role in the bacterial electron transport chain. It is a full-length protein consisting of 539 amino acids (1-539) and is classified as a probable protein kinase involved in ubiquinone biosynthesis pathways . The protein belongs to the UbiB family, which is part of the protein kinase-like (PKL) superfamily. UbiB proteins are highly conserved across various bacterial species and are essential components in coenzyme Q biosynthesis .

How does UbiB function in ubiquinone biosynthesis?

UbiB functions as a key component in the biosynthesis of ubiquinone (coenzyme Q), which is essential for cellular bioenergetics. Current research suggests that UbiB is related to the archetypal UbiB family member COQ8, whose function is critical for coenzyme Q biosynthesis . While the exact mechanism remains under investigation, UbiB is believed to function in conjunction with other Ubi proteins (such as UbiT, UbiU, and UbiV) to facilitate hydroxylation reactions necessary for ubiquinone synthesis .

UbiB likely participates in an oxygen-independent pathway for ubiquinone biosynthesis, allowing bacteria to synthesize this essential molecule even under low-oxygen conditions. This pathway represents an adaptation that enables bacteria like Pseudomonas syringae to optimize their metabolism across varying oxygen concentrations .

What expression systems are recommended for recombinant production of Pseudomonas syringae UbiB?

For recombinant production of Pseudomonas syringae UbiB, Escherichia coli expression systems are predominantly recommended. Based on established protocols, the full-length UbiB protein (1-539 amino acids) can be successfully expressed in E. coli with an N-terminal His-tag for purification purposes . The expression construct should contain the complete ubiB gene sequence from Pseudomonas syringae pv. syringae, properly cloned into an expression vector with an appropriate promoter (such as T7) for controlled induction.

When designing your expression strategy, consider the following methodological approach:

  • Clone the full-length ubiB gene into a pET-based vector with an N-terminal His-tag

  • Transform into an E. coli expression strain like BL21(DE3)

  • Induce expression with IPTG at optimal concentrations (typically 0.5-1.0 mM)

  • Grow cultures at 28-30°C rather than 37°C to enhance proper folding

  • Extract and purify using immobilized metal affinity chromatography (IMAC)

This approach yields recombinant protein suitable for further biochemical and functional characterization studies .

What are the optimal storage conditions for purified recombinant UbiB protein?

The optimal storage conditions for purified recombinant UbiB protein from Pseudomonas syringae involve:

  • Storage buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Long-term storage: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

  • Working aliquots: Store at 4°C for up to one week

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Stabilization: Add glycerol to a final concentration of 5-50% (recommended optimal concentration: 50%)

  • Avoid repeated freeze-thaw cycles as they can compromise protein stability and activity

These conditions have been experimentally determined to maintain protein integrity and activity for research applications.

How can researchers validate the functional activity of purified UbiB protein?

Validating the functional activity of purified UbiB protein requires multiple complementary approaches:

Biochemical Assays:

  • ATPase activity measurement: UbiB is believed to have protein kinase-like activity, so monitor ATP hydrolysis using coupled enzymatic assays or radioactive ATP

  • Ubiquinone precursor conversion: Track the conversion of ubiquinone precursors using HPLC or LC-MS

Structural Validation:

  • Circular dichroism (CD) spectroscopy to confirm proper protein folding

  • Size-exclusion chromatography to verify oligomeric state

Functional Complementation:

  • Express recombinant UbiB in ubiB-deficient bacterial strains

  • Measure restoration of ubiquinone biosynthesis

  • Assess growth under conditions requiring functional electron transport chains

Interaction Studies:

  • Pull-down assays to identify interacting partners in the ubiquinone biosynthesis pathway

  • Binding studies with proposed substrates using isothermal titration calorimetry (ITC)

These approaches collectively provide strong evidence for the functional integrity of the purified protein .

How does UbiB protein relate to oxygen-independent ubiquinone biosynthesis pathways?

Recent research has identified a novel oxygen-independent pathway for ubiquinone biosynthesis that functions alongside the traditional oxygen-dependent pathway. While UbiB itself appears to be involved in ubiquinone biosynthesis, the recently characterized oxygen-independent pathway involves three specific proteins: UbiT (YhbT), UbiU (YhbU), and UbiV (YhbV) .

UbiB's relationship to this pathway remains an active area of investigation, but current evidence suggests:

  • UbiB may function in both oxygen-dependent and oxygen-independent pathways

  • UbiB likely participates in protein-protein interactions with components of both pathways

  • The protein may serve as a regulatory node that coordinates biosynthetic activities based on oxygen availability

This dual-pathway system allows bacteria like Pseudomonas syringae to synthesize ubiquinone across the entire oxygen range, which is particularly important for organisms that colonize environments with fluctuating oxygen levels .

The functional relationship between UbiB and the UbiT-UbiU-UbiV system represents a fertile area for research, as elucidating these interactions could reveal new strategies for modulating bacterial metabolism.

What structural features contribute to UbiB function in Pseudomonas syringae?

While the complete three-dimensional structure of Pseudomonas syringae UbiB has not been fully resolved, several key structural features likely contribute to its function:

  • Protein Kinase-like Domain: UbiB contains motifs characteristic of protein kinases, suggesting it may use ATP binding and hydrolysis during its catalytic cycle

  • Iron-Sulfur Cluster Binding Sites: By analogy with the UbiU-UbiV system, UbiB may contain binding sites for iron-sulfur clusters that are essential for oxygen-independent hydroxylation reactions

  • Membrane Association Regions: Hydrophobic domains likely facilitate association with the membrane, where ubiquinone biosynthesis occurs

  • Protein-Protein Interaction Surfaces: Specific regions mediate interactions with other components of the ubiquinone biosynthesis machinery

  • Substrate Binding Pocket: A defined region for binding ubiquinone precursors or other pathway intermediates

Researchers can investigate these structural features through multiple approaches, including homology modeling based on related proteins, targeted mutagenesis of conserved residues, and structural studies using X-ray crystallography or cryo-electron microscopy .

How do UbiB inhibitors impact ubiquinone biosynthesis and bacterial viability?

Recent research has focused on developing small-molecule inhibitors for the archetypal UbiB family member COQ8, which could provide insights into developing inhibitors for Pseudomonas syringae UbiB. These inhibitors have significant impacts on both ubiquinone biosynthesis and bacterial viability :

  • Disruption of Ubiquinone Biosynthesis:

    • Inhibitors target the protein's ATP-binding site or allosteric regulatory sites

    • This prevents proper functioning in the ubiquinone biosynthesis pathway

    • Results in decreased coenzyme Q levels in bacterial cells

  • Effects on Electron Transport Chain:

    • Reduced ubiquinone levels impair electron transport chain function

    • Leads to decreased ATP production and disruption of energy metabolism

    • Creates oxidative stress due to electron leakage

  • Impact on Bacterial Viability:

    • Most profound under growth conditions requiring oxidative phosphorylation

    • May be bacteriostatic or bactericidal depending on inhibitor potency

    • Effects are typically oxygen-dependent, though dual-pathway inhibitors could function under all oxygen conditions

  • Therapeutic Potential:

    • UbiB inhibitors offer potential as novel antibacterial agents

    • May be particularly effective against pathogens that rely heavily on oxidative metabolism

    • Could be developed as targeted therapeutics for Pseudomonas infections

Research strategies for developing and evaluating UbiB inhibitors include crystallography-guided design, activity assays measuring ATP hydrolysis, and cellular assays monitoring ubiquinone levels .

How does Pseudomonas syringae UbiB compare to UbiB proteins in other bacterial species?

Comparative analysis of Pseudomonas syringae UbiB with homologs in other bacterial species reveals important evolutionary and functional insights:

Sequence Conservation:
UbiB proteins are widely distributed among alpha-, beta-, and gammaproteobacteria, including several human pathogens . Analysis indicates that the Pseudomonas syringae UbiB shares:

  • 75-85% sequence identity with UbiB in other Pseudomonas species

  • 60-70% identity with UbiB in other gammaproteobacteria

  • 40-50% identity with UbiB in alphaproteobacteria

Conserved Domains:
All UbiB proteins across bacterial species contain:

  • ATP-binding motifs characteristic of the protein kinase-like superfamily

  • Conserved cysteine residues potentially involved in cofactor binding

  • Membrane association domains

Functional Divergence:
While core functions are conserved, species-specific adaptations exist:

  • Some species show duplicated UbiB genes with specialized functions

  • Variations in regulatory elements controlling expression

  • Different patterns of interaction with other ubiquinone biosynthesis proteins

Evolutionary Context:
The presence of UbiB across diverse bacterial lineages suggests:

  • Ancient origin of the ubiquinone biosynthesis pathway

  • Essential role in bacterial metabolism

  • Evolutionary pressure to maintain function despite sequence divergence

This comparative analysis provides a framework for understanding the fundamental and variable aspects of UbiB function across bacterial species .

What is the relationship between UbiB and the UbiU-UbiV system in ubiquinone biosynthesis?

The relationship between UbiB and the recently characterized UbiU-UbiV system represents an important area of research in ubiquinone biosynthesis:

Functional Complementarity:

  • UbiB likely functions in the traditional oxygen-dependent pathway for ubiquinone biosynthesis

  • The UbiU-UbiV system forms a heterodimer involved in oxygen-independent hydroxylation reactions

  • Both systems contribute to optimizing bacterial metabolism across varying oxygen conditions

Structural Similarities:

  • Both UbiB and UbiU-UbiV likely bind iron-sulfur clusters

  • They share protein domains involved in ATP binding and hydrolysis

  • Both systems interact with membrane-associated components of the ubiquinone biosynthesis machinery

Regulatory Interactions:

  • Evidence suggests potential cross-regulation between these systems

  • Expression patterns may vary based on oxygen availability

  • Protein-protein interactions may coordinate their activities

Evolutionary Relationship:

  • UbiB may represent an evolutionary precursor to the UbiU-UbiV system

  • Alternatively, these systems may have evolved from a common ancestor

  • Their co-existence in many bacterial species highlights their complementary roles

Understanding this relationship could lead to more comprehensive models of ubiquinone biosynthesis and identify potential targets for antimicrobial development .

FeatureUbiBUbiU-UbiV System
Oxygen RequirementLikely oxygen-dependentOxygen-independent
Protein ComponentsSingle proteinHeterodimer of UbiU and UbiV
CofactorUnknown4Fe-4S clusters
DistributionWidely distributed in proteobacteriaAlpha-, beta-, and gammaproteobacteria
FunctionProbable role in hydroxylationConfirmed role in hydroxylation reactions

How can knockout studies be designed to investigate UbiB function in Pseudomonas syringae?

Designing effective knockout studies for investigating UbiB function in Pseudomonas syringae requires a systematic approach:

Gene Deletion Strategy:

  • Use homologous recombination to precisely delete the ubiB gene

  • Alternatively, employ CRISPR-Cas9 system for targeted gene editing

  • Create marker-free deletions to avoid polar effects on adjacent genes

  • Generate conditional knockouts using inducible systems for essential genes

Phenotypic Characterization:

  • Growth assessment under varying oxygen concentrations (aerobic, microaerobic, anaerobic)

  • Measure ubiquinone levels using HPLC or LC-MS

  • Analyze membrane potential and proton motive force

  • Assess sensitivity to oxidative stress and redox-cycling agents

  • Evaluate biofilm formation capabilities

Complementation Analysis:

  • Reintroduce wild-type ubiB gene on a plasmid

  • Test complementation with ubiB genes from related species

  • Create point mutations in conserved domains to identify essential residues

  • Express the gene under native and constitutive promoters

Metabolic Profiling:

  • Perform untargeted metabolomics to identify accumulated intermediates

  • Trace isotope-labeled precursors through the ubiquinone pathway

  • Measure changes in cellular redox state

  • Analyze expression of compensatory pathways

This comprehensive approach will provide insights into both the direct function of UbiB and its broader role in bacterial metabolism .

What protein-protein interaction methods are most suitable for studying UbiB's role in ubiquinone biosynthesis complexes?

Several complementary protein-protein interaction methodologies are particularly suitable for investigating UbiB's interactions within ubiquinone biosynthesis complexes:

In Vivo Approaches:

  • Bacterial Two-Hybrid System:

    • Fuse UbiB and potential partners to complementary fragments of a reporter protein

    • Ideal for initial screening of interaction partners

    • Can be performed in conditions mimicking native environment

  • Crosslinking Mass Spectrometry:

    • Treat bacterial cells with membrane-permeable crosslinkers

    • Isolate UbiB complexes and identify partners by mass spectrometry

    • Provides snapshots of dynamic interactions in the native context

  • Proximity-Dependent Biotin Labeling (BioID or APEX):

    • Express UbiB fused to a biotin ligase or peroxidase

    • Identify nearby proteins that become biotinylated

    • Particularly useful for transient interactions in membrane environments

In Vitro Approaches:

  • Co-Immunoprecipitation with Recombinant Proteins:

    • Express tagged versions of UbiB and potential partners

    • Perform pull-down experiments to confirm direct interactions

    • Can be coupled with site-directed mutagenesis to map interaction domains

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified UbiB on a sensor chip

    • Measure binding kinetics with potential partners

    • Quantifies affinity and binding/dissociation rates

  • Native Mass Spectrometry:

    • Analyze intact protein complexes under native conditions

    • Determines stoichiometry and stability of complexes

    • Can reveal conformational changes upon complex formation

These methods can reveal how UbiB integrates into larger complexes involved in ubiquinone biosynthesis, potentially uncovering connections to both oxygen-dependent and oxygen-independent pathways .

How can researchers design experiments to distinguish between UbiB's role in oxygen-dependent versus oxygen-independent ubiquinone biosynthesis?

Designing experiments to differentiate UbiB's involvement in oxygen-dependent versus oxygen-independent ubiquinone biosynthesis requires careful control of experimental conditions:

Oxygen-Controlled Cultivation:

  • Establish three parallel cultivation conditions:

    • Aerobic (21% O₂)

    • Microaerobic (0.5-5% O₂)

    • Anaerobic (0% O₂, using anaerobic chamber)

  • Monitor growth rates and ubiquinone production in each condition

  • Compare wild-type and ubiB knockout strains across all oxygen levels

Metabolic Labeling Studies:

  • Supply isotope-labeled precursors (e.g., ¹³C-labeled 4-hydroxybenzoate)

  • Track incorporation into ubiquinone and intermediates under different oxygen tensions

  • Identify pathway bottlenecks in ubiB mutants using metabolic flux analysis

Gene Expression Analysis:

  • Perform RNA-seq comparing gene expression at varying oxygen levels

  • Focus on coordinated expression of ubiB with:

    • Genes in conventional oxygen-dependent pathway

    • Genes in the UbiU-UbiV oxygen-independent pathway

  • Use reporter gene fusions to monitor real-time expression patterns

Biochemical Assays with Recombinant UbiB:

  • Test UbiB activity with different electron acceptors:

    • Molecular oxygen

    • Alternative electron acceptors for anaerobic conditions

  • Identify cofactors required for activity under varying oxygen conditions

  • Assess protein-protein interactions with components of both pathways

Genetic Interaction Studies:

  • Create double and triple mutants with components of:

    • Oxygen-dependent pathway genes

    • Oxygen-independent pathway genes (ubiT, ubiU, ubiV)

  • Perform synthetic lethality screening

  • Analyze epistatic relationships between pathway components

This multifaceted approach will help delineate UbiB's potentially dual role in ubiquinone biosynthesis across varying oxygen conditions .

How can research on Pseudomonas syringae UbiB contribute to developing new antimicrobial strategies?

Research on Pseudomonas syringae UbiB offers several promising avenues for novel antimicrobial development:

Targeted Inhibitor Development:

  • Structure-based design of small molecules targeting UbiB's active site

  • Development of allosteric inhibitors that disrupt essential protein-protein interactions

  • Creation of mechanism-based inhibitors that exploit UbiB's catalytic mechanism

  • Design of dual-pathway inhibitors targeting both oxygen-dependent and oxygen-independent ubiquinone biosynthesis

Antimicrobial Efficacy Enhancement:

  • UbiB inhibitors could potentiate existing antibiotics by compromising bacterial energy metabolism

  • Combination therapies targeting multiple components of the electron transport chain

  • Development of inhibitors effective against both actively growing and persister bacterial populations

  • Creation of delivery systems that target inhibitors to infection sites

Broad-Spectrum Potential:

  • The conservation of UbiB across proteobacterial species suggests broad-spectrum applications

  • Inhibitors effective against Pseudomonas syringae UbiB may work against homologs in human pathogens

  • Cross-species conservation analysis can identify universally essential residues as drug targets

Therapeutic Applications:

  • Treatment of infections caused by multidrug-resistant Pseudomonas species

  • Development of narrow-spectrum antibiotics with reduced impact on beneficial microbiota

  • Agricultural applications targeting plant pathogens like Pseudomonas syringae

  • Potential anti-virulence applications by compromising pathogen fitness without direct killing

These approaches could yield novel antimicrobials with mechanisms distinct from current antibiotics, addressing the growing problem of antimicrobial resistance .

What are the most promising techniques for resolving the structure-function relationship of UbiB?

Several cutting-edge techniques show particular promise for elucidating the structure-function relationship of UbiB:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for membrane-associated proteins like UbiB

    • Can reveal conformational changes during catalytic cycles

    • Potential to visualize UbiB within larger biosynthetic complexes

  • Integrated Structural Proteomics:

    • Combines hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry (XL-MS)

    • Limited proteolysis to map flexible and interaction regions

  • Microcrystal Electron Diffraction (MicroED):

    • Applicable to small crystals that are challenging for traditional X-ray crystallography

    • Can achieve atomic resolution for difficult-to-crystallize proteins

Functional Analysis Techniques:

  • Time-Resolved Spectroscopy:

    • Characterize intermediates formed during UbiB's catalytic cycle

    • Track conformational changes during substrate binding and product release

    • Potentially identify transient interactions with oxygen or alternative electron acceptors

  • Single-Molecule Förster Resonance Energy Transfer (smFRET):

    • Monitor conformational dynamics of individual UbiB molecules

    • Reveal heterogeneity in protein behavior

    • Characterize the effect of ligands on protein dynamics

  • AlphaFold2 and Integrative Modeling:

    • Leverage AI-based structure prediction

    • Integrate experimental constraints from multiple sources

    • Generate testable structural models even with limited experimental data

Structure-Function Correlation Approaches:

  • Deep Mutational Scanning:

    • Systematically mutate each residue and assess impact on function

    • Identify functionally critical regions beyond the active site

    • Map allosteric networks within the protein

  • Nanobody-Based Structural Analysis:

    • Develop conformation-specific nanobodies

    • Use as crystallization chaperones

    • Probe different functional states of UbiB

These techniques, particularly when used in combination, offer powerful approaches to resolve the structure-function relationship of UbiB at unprecedented resolution .

What are the key research questions that remain unanswered about UbiB's role in bacterial metabolism?

Despite advances in understanding UbiB, several critical research questions remain unanswered:

Mechanistic Questions:

  • What is the precise catalytic mechanism of UbiB in ubiquinone biosynthesis?

  • Does UbiB function as a kinase, hydroxylase, or another type of enzyme?

  • What are the specific substrates and products of UbiB-catalyzed reactions?

  • How does UbiB coordinate with other proteins in the ubiquinone biosynthesis pathway?

Regulatory Questions:

  • How is UbiB expression regulated in response to oxygen availability?

  • What post-translational modifications modulate UbiB activity?

  • How do bacteria coordinate the oxygen-dependent and oxygen-independent pathways?

  • What environmental signals besides oxygen affect UbiB function?

Structural Questions:

  • What is the three-dimensional structure of UbiB, particularly in its membrane-associated state?

  • How does substrate binding induce conformational changes?

  • What cofactors are required for UbiB activity?

  • How do protein-protein interactions alter UbiB structure and function?

Evolutionary Questions:

  • How did the dual pathway system for ubiquinone biosynthesis evolve?

  • Why have bacteria maintained both oxygen-dependent and oxygen-independent pathways?

  • How does UbiB diversity relate to bacterial ecological niches?

  • What selective pressures drive UbiB evolution?

Applied Research Questions:

  • Can UbiB inhibition be exploited for species-specific antimicrobial development?

  • How does UbiB contribute to bacterial adaptation during infection?

  • Is UbiB function linked to virulence or antibiotic resistance?

  • Can manipulation of UbiB activity alter bacterial community dynamics?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology .

What are the most effective approaches for studying oxygen-dependent versus oxygen-independent ubiquinone biosynthesis?

Studying the dual pathways of ubiquinone biosynthesis requires specialized techniques to distinguish oxygen-dependent from oxygen-independent mechanisms:

Controlled Atmosphere Systems:

  • Utilize bioreactors with precise oxygen control (0-21% O₂)

  • Employ anaerobic chambers with integrated analytical capabilities

  • Develop microfluidic systems for real-time observation of bacterial responses to oxygen gradients

  • Use oxygen-sensing fluorophores to monitor local oxygen concentrations

Genetic Manipulation Strategies:

  • Generate pathway-specific knockout strains:

    • ΔubiB (targeting conventional pathway)

    • ΔubiU, ΔubiV (targeting oxygen-independent pathway)

    • Various combinations of double and triple knockouts

  • Create complementation strains with controlled expression

  • Develop fluorescent reporter systems for pathway activity

Metabolic Analysis Techniques:

  • Isotope Tracing Studies:

    • Use ¹³C or ¹⁸O labeled precursors

    • Track isotope incorporation using LC-MS/MS

    • Identify pathway-specific intermediates

  • In Vivo Metabolic Flux Analysis:

    • Measure flux through both pathways simultaneously

    • Identify metabolic bottlenecks under varying oxygen conditions

    • Quantify pathway contributions to total ubiquinone production

Biochemical Assays:

  • Develop in vitro reconstitution systems for:

    • Oxygen-dependent hydroxylation reactions

    • Oxygen-independent hydroxylation reactions

  • Compare kinetic parameters between pathways

  • Test pathway interchangeability of intermediates

Data Integration Approaches:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Computational modeling of pathway flux

  • Machine learning for pattern recognition in complex datasets

These approaches collectively provide a comprehensive toolkit for dissecting the complex interplay between oxygen-dependent and oxygen-independent ubiquinone biosynthesis pathways .

How can researchers address the challenges of expressing and purifying membrane-associated proteins like UbiB?

Membrane-associated proteins like UbiB present unique challenges for expression and purification. Here are methodological solutions to address these challenges:

Optimized Expression Strategies:

  • Expression Host Selection:

    • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Consider Pseudomonas-based expression systems for native-like environment

    • Explore cell-free expression systems to avoid toxicity issues

  • Vector Design:

    • Utilize low-copy number vectors to prevent overwhelming membrane insertion machinery

    • Include fusion partners that enhance membrane targeting and stability

    • Incorporate inducible promoters with tight regulation

  • Culture Conditions:

    • Lower induction temperature (16-25°C) to slow production and improve folding

    • Add specific lipids to culture media to support membrane protein assembly

    • Use chemical chaperones to enhance proper folding

Effective Solubilization Approaches:

  • Detergent Screening:

    • Systematically test mild detergents (DDM, LMNG, Digitonin)

    • Evaluate nonionic, zwitterionic, and mixed micelle systems

    • Optimize detergent concentration for each purification step

  • Alternative Solubilization Methods:

    • Employ styrene-maleic acid lipid particles (SMALPs) for native lipid environment preservation

    • Utilize amphipols for enhanced stability during purification

    • Investigate nanodiscs for functional studies

Purification Optimization:

  • Multi-Step Purification Strategy:

    • Initial IMAC purification using His-tag

    • Secondary affinity step or ion exchange chromatography

    • Final size exclusion chromatography in stabilizing buffer

  • Buffer Optimization:

    • Include lipids or lipid-like molecules in purification buffers

    • Optimize salt concentration to minimize aggregation

    • Add stabilizers like glycerol or specific binding partners

  • Quality Control:

    • Assess monodispersity using dynamic light scattering

    • Verify proper folding using circular dichroism

    • Confirm functionality with activity assays

This systematic approach maximizes the chances of obtaining pure, properly folded, and functional UbiB protein for structural and biochemical studies .

What computational approaches are most useful for predicting UbiB function and interactions?

Modern computational approaches offer powerful tools for predicting UbiB function and interactions:

Structural Bioinformatics:

  • AlphaFold2 and RoseTTAFold Modeling:

    • Generate high-confidence structural models of UbiB

    • Predict conformational states and binding pockets

    • Identify potential allosteric sites

  • Molecular Dynamics Simulations:

    • Model UbiB behavior in membrane environments

    • Simulate substrate binding and product release

    • Predict conformational changes during catalytic cycle

    • Typical simulation timescales: 100ns-1μs for standard MD; 10-100μs for enhanced sampling methods

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Model chemical reactions catalyzed by UbiB

    • Elucidate electron transfer mechanisms

    • Calculate energy barriers for proposed reaction mechanisms

Network Analysis and Systems Biology:

  • Protein-Protein Interaction Prediction:

    • Use sequence-based methods (e.g., co-evolutionary analysis)

    • Apply structure-based protein docking

    • Integrate experimental data with predictive algorithms

  • Metabolic Network Analysis:

    • Model flux through ubiquinone biosynthesis pathways

    • Predict metabolic consequences of UbiB inhibition

    • Simulate cellular adaptation to varying oxygen conditions

Machine Learning Applications:

  • Function Prediction:

    • Train models on known UbiB family members

    • Identify novel functional motifs

    • Predict effects of mutations on protein activity

  • Drug Discovery:

    • Virtual screening for potential UbiB inhibitors

    • De novo design of targeted compounds

    • Prediction of pharmacokinetic properties

Data Integration Frameworks:

  • Multi-omics Data Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify condition-specific regulatory patterns

    • Construct comprehensive models of UbiB in bacterial physiology

  • Knowledge Graphs:

    • Integrate literature-derived information

    • Connect UbiB to broader cellular processes

    • Generate testable hypotheses for experimental validation

These computational approaches, particularly when used in complementary combinations, can guide experimental design and provide mechanistic insights beyond the reach of experimental techniques alone .

What are the most promising future research directions for understanding UbiB function?

The most promising future research directions for understanding UbiB function span from molecular mechanisms to systems-level approaches:

Mechanistic Studies:

  • Resolving the atomic structure of UbiB using cryo-EM or X-ray crystallography

  • Identifying specific substrates and products using untargeted metabolomics

  • Determining the chemical mechanism of UbiB-catalyzed reactions

  • Characterizing potential metal cofactors and their roles in catalysis

Integrative Approaches:

  • Mapping the complete interactome of UbiB in different oxygen conditions

  • Elucidating the regulatory network controlling UbiB expression

  • Developing comprehensive models of ubiquinone biosynthesis incorporating both oxygen-dependent and oxygen-independent pathways

  • Investigating UbiB's role in bacterial adaptation to changing environments

Translational Research:

  • Structure-based design of UbiB inhibitors as potential antimicrobials

  • Exploring the connection between UbiB function and bacterial virulence

  • Investigating UbiB as a target for controlling plant pathogenic bacteria

  • Engineering UbiB for enhanced ubiquinone production in biotechnology applications

Evolutionary Studies:

  • Reconstructing the evolutionary history of ubiquinone biosynthesis pathways

  • Comparing UbiB function across diverse bacterial species

  • Investigating potential horizontal gene transfer of UbiB and related genes

  • Understanding why dual biosynthetic pathways have been maintained in many bacterial lineages

These research directions will collectively advance our understanding of UbiB's fundamental role in bacterial metabolism and its potential applications in medicine and biotechnology .

How might UbiB research contribute to our understanding of bacterial adaptation to varying oxygen conditions?

UbiB research offers significant insights into bacterial adaptation to varying oxygen conditions:

Metabolic Flexibility:

  • UbiB may serve as a key component allowing bacteria to maintain electron transport chain function across oxygen gradients

  • Understanding UbiB's role could reveal how bacteria optimize energy production in fluctuating environments

  • This knowledge may explain the remarkable adaptability of bacterial pathogens during infection

Niche Colonization:

  • The ability to produce ubiquinone under both aerobic and anaerobic conditions enables bacteria to colonize diverse ecological niches

  • UbiB research may reveal adaptation mechanisms used by bacteria in microoxic environments like biofilms

  • This understanding could explain how pathogens like Pseudomonas persist in oxygen-limited infection sites

Stress Response Integration:

  • UbiB likely participates in coordinating bacterial responses to oxidative stress

  • Its function may link redox sensing to metabolic adaptation

  • This connection could explain how bacteria maintain redox balance during environmental transitions

Evolutionary Implications:

  • Understanding UbiB's role in dual-pathway systems may reveal evolutionary strategies for metabolic resilience

  • Research could uncover how ancient bacteria adapted to Earth's increasing oxygen levels

  • This knowledge might identify conserved adaptation mechanisms used across bacterial species

Biotechnological Applications:

  • Insights from UbiB research could lead to engineered bacteria with enhanced performance in varying oxygen conditions

  • This could improve industrial bioprocesses that experience oxygen fluctuations

  • Potential applications in bioremediation of environments with heterogeneous oxygen distribution

These contributions collectively enhance our understanding of a fundamental aspect of bacterial physiology—adaptation to oxygen availability—with implications from ecology to medicine .

What methodological advances are needed to fully characterize UbiB's role in ubiquinone biosynthesis?

Several methodological advances would significantly enhance our ability to characterize UbiB's role in ubiquinone biosynthesis:

Advanced Structural Biology Techniques:

  • Development of improved methods for membrane protein crystallization

  • Enhancement of cryo-EM resolution for smaller membrane proteins

  • Advanced NMR techniques for studying membrane protein dynamics

  • Methods to capture transient catalytic intermediates of UbiB

In situ Visualization Approaches:

  • Single-molecule tracking of UbiB in living bacterial cells

  • Super-resolution microscopy techniques to visualize UbiB within bacterial membranes

  • Correlative light and electron microscopy to connect UbiB localization with ultrastructure

  • Expansion microscopy protocols optimized for bacterial samples

Real-time Activity Monitoring:

  • Development of fluorescent or bioluminescent reporters for ubiquinone biosynthesis

  • FRET-based biosensors for detecting UbiB activity in living cells

  • Label-free techniques for monitoring enzymatic turnover in real-time

  • Electrochemical methods to track electron transfer during UbiB catalysis

Multi-omics Integration Tools:

  • Advanced computational frameworks for integrating diverse -omics datasets

  • Machine learning algorithms specifically designed for membrane protein analysis

  • Network modeling approaches that incorporate dynamic oxygen responses

  • User-friendly software for simulating metabolic flux through parallel biosynthetic pathways

High-throughput Screening Methods:

  • Microfluidic platforms for rapid testing of UbiB variants

  • Automated systems for parallel purification and characterization

  • Miniaturized assays for ubiquinone detection compatible with plate-based screening

  • Droplet-based single-cell analysis of UbiB function

These methodological advances would collectively overcome current technical limitations and accelerate our understanding of UbiB's precise role in the complex process of ubiquinone biosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.