Recombinant Pseudomonas syringae pv. syringae Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas syringae pv. syringae Prolipoprotein Diacylglyceryl Transferase (lgt)

Recombinant Pseudomonas syringae pv. syringae Prolipoprotein Diacylglyceryl Transferase (lgt) is a recombinant form of the enzyme lgt, which is crucial for the modification of prolipoproteins in bacteria. This enzyme catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, a process essential for bacterial membrane protein maturation and function .

Characteristics of Recombinant Pseudomonas syringae pv. syringae lgt

The recombinant form of this enzyme is typically expressed in Escherichia coli and is available as a His-tagged protein for easier purification and identification. Key characteristics include:

CharacteristicDescription
SourceExpressed in Escherichia coli
TagN-terminal His tag
Protein LengthFull length (1-270 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Function and Importance of lgt in Bacteria

The lgt enzyme plays a critical role in bacterial physiology by facilitating the modification of prolipoproteins, which are essential for various cellular processes, including membrane integrity and protein function. In Gram-negative bacteria like Pseudomonas syringae, this modification is necessary for the proper anchoring of lipoproteins to the bacterial membrane .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please specify your needs when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Psyr_4841; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVAVAIGPLQIHWYGLMYLVGIGGAWLLASRRLNKFDPTWTKEKLSDLIFWL AMGVIVGGRLGYVLFYDLSAYIANPLLIFEVWKGGMAFHGGFVGVMIAAWWFGKRNGKSF FQLMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMVFPPFSDPAQLARHPSQLYQF ALEGVALFIILNLYARKPRPTMAVSGMFALFYGIFRFVVEFVRVPDAQLGYLAWGWVTMG QILSLPMIIAGLLLIWLAYKRDPSASKAAA
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is Lgt across bacterial species?

Lgt is highly conserved across both Gram-negative and Gram-positive bacteria, though with some structural variations that affect substrate specificity. Sequence analysis reveals that P. syringae Lgt shares significant homology with Lgt from other Gram-negative bacteria, particularly within the Pseudomonas genus .

Recent phylogenetic studies on Lgt homologs have identified a 13-residue Lgt motif that is characteristic of the enzyme family. This motif contains four invariant residues that are critical for function . The arm and head domains of Lgt have been found to determine functional diversity among bacterial pathogens, suggesting evolutionary adaptation to specific ecological niches .

When comparing P. syringae Lgt with the well-characterized Lgt from E. coli, several conserved residues that are essential for function can be identified. In E. coli, residues Y26, N146, and G154 are absolutely required for Lgt function, while R143, E151, R239, and E243 are important but not critical. These residues are likely similarly important in P. syringae Lgt due to functional conservation .

What are the optimal conditions for culturing P. syringae in laboratory settings?

For successful work with P. syringae and its recombinant proteins, proper culture conditions are essential:

Temperature: P. syringae is typically grown at room temperature (~25°C) and cannot tolerate prolonged exposure to 37°C, which is lethal to the bacterium .

Media: Several media types support growth of P. syringae:

  • LB (Luria-Bertani) medium

  • TSB (Tryptic Soy Broth)

  • KB (King's Broth)

Growth characteristics:

  • Liquid cultures typically require one day to reach sufficient density

  • Colonies appear on solid media after one day, with optimal colony size reached on the second day

  • Growth in minimal media may require longer incubation periods

Antibiotic resistance profile (strain-dependent):

AntibioticPsy508Psy642
Carbapenem (CRB)Resistant up to 2×Resistant up to 3×
Chloramphenicol (CAM)Not resistantResistant up to 2×
Spectinomycin (SPEC)Not resistantResistant up to 2×
Tetracycline (TET)Not resistantNot resistant
Kanamycin (KAN)Not resistantNot resistant

What methods are effective for heterologous expression and purification of P. syringae Lgt?

Heterologous expression of P. syringae Lgt presents challenges due to its membrane-embedded nature. Based on successful approaches with similar proteins, the following methodology is recommended:

Expression system selection:

  • E. coli BL21(DE3) or C41/C43 strains (specialized for membrane protein expression)

  • Expression vectors with tunable promoters like pBAD or pET systems

  • Inclusion of affinity tags (His6 or c-myc) at the C-terminus to facilitate purification while maintaining function

Expression conditions optimization:

  • Lower temperatures (16-25°C) during induction to improve proper folding

  • Reduced inducer concentrations to prevent toxicity

  • Growth in media supplemented with additional phospholipids to support membrane protein insertion

Membrane protein extraction and purification:

  • Cell disruption by sonication or French press

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using mild detergents (DDM, LDAO, or Triton X-100)

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography for final polishing

Activity verification:

  • In vitro enzymatic assays using synthetic peptide substrates

  • Complementation studies in Lgt-depleted bacterial strains

How can site-directed mutagenesis be applied to study critical residues in P. syringae Lgt?

Site-directed mutagenesis is a powerful approach to determine the functional importance of specific residues in P. syringae Lgt. Based on established protocols for Lgt studies, the following methodology is recommended:

Target residue selection:

  • Highly conserved residues identified through multiple sequence alignment

  • Residues within the Lgt signature motif

  • Residues in the predicted catalytic cavity or substrate binding regions

Mutagenesis protocol:

  • Two-step PCR method based on the Quick-Change site-directed mutagenesis protocol

  • Design of complementary synthetic oligonucleotides containing the desired mutation

  • Use of a high-fidelity DNA polymerase to minimize unwanted mutations

  • DpnI digestion to eliminate template DNA

  • Transformation into a cloning strain of E. coli

  • Sequence verification of the mutant constructs

Functional analysis of mutants:

  • Expression verification by Western blotting

  • Growth complementation studies in Lgt-depleted strains

  • Morphological analysis of cells expressing mutant variants

  • Biochemical characterization of purified mutant proteins

Example of critical residues based on studies in E. coli Lgt:

ResidueLocationEffect of Alanine Substitution
Y26TM-1Non-functional, no growth
G98Between arm-2 and TM-3Delayed growth
G104TM-3Delayed growth
H103TM-3Growth to mid-exponential phase, then lysis
R143TM-4Non-functional, no growth
N146TM-4Non-functional, no growth
E151Loop between TM-4 and head domainDelayed growth
G154Loop between TM-4 and head domainNon-functional, no growth
R239TM-6Non-functional, no growth
E243Not specifiedViable, normal growth

These findings from E. coli Lgt can guide similar studies in P. syringae Lgt .

What are effective strategies for genetic manipulation of the lgt gene in P. syringae?

Genetic manipulation of lgt in P. syringae requires specialized approaches due to the gene's essential nature. Based on research with similar systems, the following strategies are recommended:

Conditional expression systems:

  • Tetracycline-inducible CRISPRi for knockdown studies without complete deletion

  • Arabinose-inducible expression systems for complementation studies

  • Temperature-sensitive replicons for conditional expression

Recombineering approaches:
P. syringae possesses homologs of the RecE and RecT proteins from bacteriophages that can be exploited for precise genetic manipulation:

  • RecT-mediated recombination for single-stranded DNA oligonucleotides:

    • The P. syringae RecT homolog alone is sufficient

    • Ideal for introducing point mutations or small modifications

    • Higher efficiency than double-stranded DNA recombination

  • RecTE-mediated recombination for double-stranded DNA:

    • Requires expression of both RecE and RecT homologs

    • Suitable for larger genetic modifications

    • The RecE exonuclease processes dsDNA to expose 3' ssDNA ends that RecT can bind

Transformation protocol for P. syringae:

  • Grow an overnight culture in liquid LB medium

  • Dilute to OD600 of ~0.1 in 50 mL fresh medium

  • Grow to mid-log phase

  • Harvest cells and wash with ice-cold electroporation buffer

  • Resuspend in a small volume of electroporation buffer

  • Mix cells with DNA substrate

  • Electroporate and immediately add recovery medium

  • Plate on selective media

Counterselection strategies:

  • The Bacillus subtilis sacB gene encoding levansucrase can be used as a counterselectable marker

  • Growth on media containing 5-10% sucrose is lethal to cells expressing sacB

  • Allows for plasmid curing after desired genetic modifications

How does temperature affect Lgt function in P. syringae, particularly in relation to cold adaptation?

P. syringae is notable for its adaptation to cold environments, with some strains isolated from Antarctic habitats. While the direct effects of temperature on Lgt function in P. syringae have not been extensively characterized, several aspects of cold adaptation are relevant:

Effects of cold temperature on cellular processes in P. syringae:

  • DNA replication encounters barriers at low temperatures (4°C), leading to frequent replication fork arrest and reversal

  • The RecBCD complex becomes essential for DNA repair and growth at low temperatures

  • All three subunits (RecB, RecC, and RecD) are required for DNA repair and cold temperature growth, unlike in E. coli where RecD is dispensable

Potential implications for Lgt function:

  • Membrane fluidity changes at low temperatures likely affect the activity of membrane-embedded enzymes like Lgt

  • P. syringae may have evolved specific adaptations in Lgt structure to maintain function at low temperatures

  • The protein substrate specificity of Lgt might be influenced by temperature, potentially through conformational changes in the arm and head domains

Cold adaptation mechanisms relevant to Lgt:

  • P. syringae produces ice nucleation proteins (INPs) that function at temperatures between -1.8 to -3.8°C

  • Lipoprotein processing may be adapted to maintain efficiency at low temperatures

  • The association of lipoproteins with the cell envelope could play a role in maintaining membrane integrity under cold stress

Experimental approaches to study temperature effects on Lgt function would include:

  • Enzyme activity assays at various temperatures

  • Thermal stability measurements of purified P. syringae Lgt

  • Lipidomic analysis to detect temperature-dependent changes in membrane composition

  • Comparative analyses of Lgt from psychrophilic, mesophilic, and thermophilic bacteria

What is the role of Lgt in P. syringae pathogenicity and plant-microbe interactions?

P. syringae is a significant plant pathogen causing diseases in numerous agronomically important crops. The role of Lgt in its pathogenicity can be inferred from studies on bacterial lipoproteins and pathogenesis:

Lipoproteins in host-pathogen interactions:

  • Function as pathogen-associated molecular patterns (PAMPs) recognized by plant immune receptors

  • May be involved in adhesion to plant surfaces

  • Can participate in nutrient acquisition during plant colonization

  • May contribute to biofilm formation on plant surfaces

Evidence from other bacterial pathogens:
Studies in various bacteria show complex and sometimes contradictory roles for Lgt in pathogenicity:

Potential roles in P. syringae virulence:

  • Processing of lipoproteins involved in type III secretion system function

  • Contribution to environmental stress resistance during plant colonization

  • Potential involvement in alginate production, which is regulated by AlgT (σ22) and contributes to virulence and stress tolerance

  • Possible role in ice nucleation activity, which can cause frost damage to plants

Research approaches to elucidate Lgt's role in P. syringae pathogenicity would include:

  • Construction of conditional Lgt mutants

  • Plant infection assays with Lgt-depleted strains

  • Identification of specific lipoproteins processed by Lgt that contribute to virulence

  • Transcriptomic and proteomic analyses of Lgt-depleted strains during plant infection

How does P. syringae Lgt fit into the broader evolutionary context of the P. syringae species complex?

P. syringae represents a diverse bacterial species complex with significant genetic variation. Understanding Lgt in this evolutionary context provides insights into bacterial adaptation:

Phylogenetic structure of the P. syringae species complex:

  • Divided into primary and secondary phylogroups

  • Primary phylogroups predominantly comprise agricultural isolates

  • Secondary phylogroups include numerous environmental isolates

  • Phylogroups exhibit genetic diversity levels typically found among distinct species

Recombination patterns relevant to Lgt evolution:

  • Higher rates of recombination within primary phylogroups than between primary and secondary phylogroups

  • "Ecologically significant" virulence-associated loci and "evolutionarily significant" loci under positive selection are over-represented among loci that undergo inter-phylogroup genetic exchange

Lgt as a potential core function:
As an essential enzyme for bacterial viability, Lgt likely belongs to the core genome of P. syringae. The core genome phylogeny of P. syringae has been reconstructed using 2410 core genes, and Lgt would be among these conserved functions .

Comparative genomic context:
A phylogenomic analysis of 494 complete genomes from the entire Pseudomonas genus showed that P. syringae is part of a wider evolutionary group that includes other species such as P. avellanae, P. savastanoi, P. amygdali, and P. cerasi . Lgt function likely extends across this broader group, with potential variations in substrate specificity.

How do structural variations in Lgt affect substrate specificity across bacterial species?

Recent research has revealed important insights into how structural variations in Lgt affect its substrate specificity across bacterial species:

Key structural determinants of substrate specificity:

  • The arm and head domains of Lgt play crucial roles in determining protein substrate specificity

  • A large-scale analysis has led to the definition of a 13-residue Lgt motif that characterizes the enzyme family

  • Variations in this motif likely contribute to differences in substrate recognition and processing efficiency

Catalytic mechanism insights:

  • Histidine 103, together with other conserved residues, appears critical for the catalytic function of Lgt

  • Recent research has proposed an alternative catalytic mechanism based on structural and functional analyses

  • This mechanism likely applies across bacterial species but may have subtle variations

Implications for antibiotic development:

  • Similarities in catalytic mechanism across bacterial Lgt homologs suggest potential for broad-spectrum antibiotics

  • Differences in substrate specificity between Lgt homologs from different pathogenic species could be exploited for narrow-spectrum antibiotics

  • Understanding these variations is crucial for developing targeted therapeutic approaches

Experimental approaches to study substrate specificity:

  • Domain swapping between Lgt enzymes from different species

  • Site-directed mutagenesis of residues in the arm and head domains

  • In vitro assays with diverse lipoprotein substrates

  • Structural studies of Lgt-substrate complexes

This research area represents an exciting frontier for understanding bacterial adaptation and for developing new antimicrobial strategies that target essential cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.