Recombinant Pseudomonas syringae pv. syringae Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
secG; Psyr_4183; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
secG
Target Protein Sequence
MLETVVIVFHLLGALGVVALVLLQQGKGADAGASFGAGASNTVFGGQGTSTFLSKFTAIL AACFFITSLGLGYFAKEKAQQLTQVGLPDPAVLEVKQKPAADDVPVLEGQKPAAVPADVP QAPEKK
Uniprot No.

Target Background

Function

Function: Involved in protein export and participates in an early stage of protein translocation.

Database Links
Protein Families
SecG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SecG in P. syringae protein secretion?

SecG is a membrane component of the protein translocation apparatus in bacteria including P. syringae. It functions as part of the Sec pathway, which is responsible for exporting proteins across the cytoplasmic membrane. Based on studies in other bacterial systems, SecG undergoes membrane topology inversion that is coupled to the membrane insertion and deinsertion cycle of SecA, thereby facilitating protein translocation . In the context of P. syringae as a plant pathogen, protein secretion systems are essential for its pathogenicity, as they enable the delivery of virulence factors to host plant cells .

How does SecG structure relate to its function in bacterial protein export?

SecG exists as a homodimer in the protein translocation machinery, with two SecG molecules closely co-existing in a single translocation complex . This dimeric structure is maintained through disulfide bonds between cysteine residues in the periplasmic regions of the protein. Importantly, studies have shown that this dimerization does not abolish SecG function, suggesting that the dimeric state is compatible with its role in protein translocation . The ability of SecG to undergo topology inversion during the protein translocation process is a distinctive feature that contributes to the efficiency of the Sec pathway.

What experimental methods are used to study SecG topology and function?

Researchers typically employ cysteine scanning mutagenesis to study SecG topology and function. This approach involves:

  • Construction of SecG derivatives with single cysteine residues at various positions

  • Expression of these derivatives in secG null mutants

  • Labeling with membrane-permeable or -impermeable sulfhydryl reagents

  • Analysis of accessibility of these reagents to the cysteine residues before and after membrane solubilization

This methodology allows determination of the topological arrangement of SecG in the membrane and assessment of topology inversions during protein translocation. Functional assays measuring protein translocation efficiency both in vivo and in vitro are used to confirm that the SecG-Cys derivatives retain their function .

How does SecG contribute to P. syringae virulence mechanisms?

As a component of the general secretory pathway, SecG likely contributes to P. syringae virulence by facilitating the export of various proteins involved in pathogenicity. P. syringae utilizes multiple secretion systems to deliver virulence factors, with the Type III secretion system (T3SS) being particularly important for injecting effector proteins directly into host cells . While the T3SS has its own specialized components, the Sec pathway may play a supporting role in the secretion of some virulence-associated proteins or in the assembly of secretion machinery components.

What is the relationship between SecG and specialized secretion systems in P. syringae?

P. syringae employs several specialized secretion systems, particularly the T3SS and T6SS, to deliver effector proteins that modulate host immunity and create favorable conditions for bacterial proliferation . The general Sec pathway, including SecG, may contribute to the export of components of these specialized secretion systems. While T3SS and T6SS effectors are secreted through their respective pathways, the assembly of these secretion machineries may depend on functional Sec-mediated protein export . Experimental evidence from proteomic analyses of P. syringae secretomes has highlighted the diversity and strain-specific nature of secreted virulence factors .

How do variations in secretion system components correlate with P. syringae virulence?

Research on different P. syringae pathovars has revealed that:

  • Strains with different virulence levels exhibit distinct patterns of effector secretion

  • Low virulence strains often secrete large amounts of a defined spectrum of T3SS effectors

  • High virulence strains typically have a broader spectrum of effectors secreted in lower abundance

  • Medium and high virulence strains secrete an additional subset of T6SS effectors not found in low virulence strains

These findings suggest that virulence in P. syringae is not simply related to the quantity of secreted effectors but rather to the specific composition and balance of the effector repertoire. Understanding SecG's contribution to this balance is an important area for further research.

What are the optimal conditions for recombinant expression of P. syringae SecG?

Based on established protocols for membrane protein expression, the following approach is recommended for recombinant expression of P. syringae SecG:

ParameterRecommended ConditionRationale
Expression SystemE. coli BL21(DE3) or C43(DE3)Optimized for membrane protein expression
VectorpET or pBAD seriesTunable expression levels
Induction0.1-0.5 mM IPTG or 0.002-0.02% arabinoseLow inducer concentrations minimize toxicity
Temperature16-20°C post-inductionReduces inclusion body formation
Media Supplements0.5-1% glucose pre-inductionReduces leaky expression
Extraction BufferTypically contains 20 mM Tris-HCl, 300 mM NaCl, pH 8.0 with appropriate detergentsMaintains protein stability

When working with SecG, it's crucial to verify that recombinant constructs retain functionality, as demonstrated in studies where SecG-Cys derivatives maintained the ability to stimulate protein translocation both in vivo and in vitro .

How can SecG topology inversion be monitored during protein translocation?

SecG topology inversion can be monitored using the following methodological approaches:

  • Cysteine accessibility assays: By placing cysteine residues at strategic positions and using membrane-permeable or -impermeable sulfhydryl reagents, researchers can track changes in accessibility that indicate topology inversion .

  • Disulfide crosslinking analysis: This approach monitors the formation of disulfide bonds between engineered cysteine residues that come into proximity during the inversion process.

  • Protease protection assays: These assays exploit the differential sensitivity of protein regions to proteolytic digestion depending on their location relative to the membrane.

  • Fluorescence resonance energy transfer (FRET): By attaching fluorescent probes to specific domains of SecG, conformational changes during topology inversion can be detected in real-time.

The choice of method depends on the specific aspects of SecG dynamics being investigated and the experimental system being used.

What approaches can verify SecG's role in effector protein secretion in P. syringae?

To establish SecG's contribution to effector protein secretion in P. syringae, researchers can employ:

  • SecG gene knockout studies: Comparing the secretome profiles of wild-type and ΔsecG mutant strains under conditions that mimic the apoplast environment .

  • Complementation experiments: Restoring SecG function in knockout strains with wild-type or mutated SecG variants to identify critical functional domains.

  • Quantitative proteomics: Using mass spectrometry-based approaches to analyze changes in the abundance of secreted proteins, particularly T3SS and T6SS effectors, in strains with modified SecG expression .

  • Fluorescent protein tagging: Monitoring the subcellular localization and secretion of tagged effector proteins in the presence of normal or altered SecG.

  • Virulence assays: Assessing changes in pathogenicity in plant infection models when SecG function is compromised.

These approaches collectively provide a comprehensive understanding of SecG's role in the complex secretion processes that underpin P. syringae pathogenicity.

How does the dimeric structure of SecG contribute to protein translocation efficiency?

The observation that SecG exists as a homodimer in the protein translocation machinery raises important questions about the functional significance of this dimeric structure. Research suggests that:

  • The proximity of two SecG molecules may create a more stable channel or support structure for the translocation pore

  • Coordinated topology inversion of both SecG molecules might enhance the efficiency of protein movement across the membrane

  • The dimeric structure could facilitate interactions with other components of the Sec pathway, particularly SecA

Experimental approaches to investigate this question include creating SecG variants that cannot dimerize and assessing their impact on protein translocation rates, as well as structural studies to determine precisely how the two SecG molecules are arranged relative to each other and to other Sec components.

How does SecG function integrate with specialized secretion systems in bacterial pathogens?

While the T3SS and T6SS in P. syringae have received considerable attention for their roles in virulence , the potential interplay between these specialized systems and the general Sec pathway remains less understood. Advanced research questions include:

  • Does SecG-dependent protein export contribute to the assembly or maintenance of T3SS or T6SS machinery?

  • Are certain effector proteins dependent on both the Sec pathway and specialized secretion systems for proper folding, modification, or targeting?

  • How do regulatory networks coordinate SecG-mediated export with T3SS and T6SS activity during infection?

Comparative secretome analysis between wild-type and SecG-deficient strains under infection-mimicking conditions could reveal proteins whose secretion depends on both systems . Temporal studies examining the sequence of secretion events during infection may also provide insights into the coordination between these systems.

What genomic adaptations in the secG gene contribute to host-specific pathogenicity of P. syringae pathovars?

P. syringae is known for its diverse pathovars that exhibit host specificity, with genomic adaptations playing a key role in this specialization . Research questions regarding secG in this context include:

  • Are there sequence variations in secG across P. syringae pathovars that correlate with host range or virulence?

  • Has the secG gene undergone horizontal gene transfer or convergent evolution similar to other virulence-associated genes in P. syringae ?

  • How does selection pressure from different plant hosts influence secG evolution?

Comparative genomic and phylogenetic analyses of secG sequences from multiple P. syringae pathovars, combined with functional studies of variant SecG proteins, could address these questions. Such research would contribute to our understanding of the molecular basis of host specialization in this important plant pathogen.

How does SecG contribute to the "two-tier" virulence strategy of P. syringae?

P. syringae employs a two-tier virulence strategy involving suppression of host immunity and creation of an aqueous apoplast environment . Research questions regarding SecG's role in this strategy include:

  • Does SecG-dependent protein export contribute to either or both of these virulence tiers?

  • How does SecG function under the environmental conditions of the plant apoplast?

  • Are there host-derived signals that modulate SecG activity during infection?

Experimental approaches to address these questions might include studying SecG function under apoplast-mimicking conditions and analyzing the impact of SecG deficiency on the bacterium's ability to suppress host immunity or modify the apoplast environment.

What is the relationship between SecG function and phytotoxin production in P. syringae?

P. syringae produces various phytotoxins, such as coronatine and syringomycin, which contribute to its virulence . The relationship between SecG-dependent protein export and phytotoxin production raises several research questions:

  • Does SecG contribute to the export of enzymes involved in phytotoxin biosynthesis?

  • How does the balance between phytotoxin production and effector secretion affect P. syringae virulence strategies?

  • Can modifications to SecG function alter the phytotoxin profile of P. syringae strains?

A systematic analysis of phytotoxin production in wild-type versus SecG-deficient strains, combined with metabolomic and transcriptomic approaches, could provide insights into these questions.

The following table summarizes the current understanding of P. syringae virulence factors and potential SecG involvement:

Virulence FactorFunctionPotential SecG Involvement
T3SS EffectorsSuppress host immunity, alter cellular processesMay contribute to secretion of T3SS components
T6SS EffectorsTarget both plant cells and competing microbesMay support T6SS assembly
Phytotoxins (e.g., coronatine)Mimic plant hormones, induce stomatal openingMay export biosynthetic enzymes
Syringomycin/SyringopeptinMembrane disruption, ion leakageMay export biosynthetic enzymes
ExopolysaccharidesBiofilm formation, protection from environmental stressMay export biosynthetic enzymes

How might targeting SecG function affect potential bacterial control strategies?

Given SecG's fundamental role in protein export, it represents a potential target for developing novel antibacterial strategies against P. syringae. Research questions in this area include:

  • Would inhibition of SecG function specifically reduce P. syringae virulence without affecting beneficial microbes?

  • Can small molecules that target SecG topology inversion be identified as potential antimicrobial agents?

  • How would P. syringae adapt to selective pressure targeting SecG function?

Research approaches might include high-throughput screening for SecG inhibitors, testing their effects on P. syringae virulence in plant infection models, and studying the development of resistance to such inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.