Recombinant Pseudomonas syringae pv. syringae Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function

UppP catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for peptidoglycan and lipopolysaccharide biosynthesis:

UPP+H2OUP+Phosphate[2]\text{UPP} + \text{H}_2\text{O} \rightleftharpoons \text{UP} + \text{Phosphate} \quad[2]

Key Functional Insights:

  • Cofactor Dependency: Activity is enhanced by Ca²⁺ and other divalent cations .

  • Antibiotic Resistance: UppP confers resistance to bacitracin by recycling UP, bypassing bacitracin’s inhibition of dephosphorylation .

  • Membrane Localization: As an integral membrane protein, UppP operates at the interface of lipid metabolism and cell wall synthesis .

4.1. Antibiotic Resistance Studies

  • UppP deletion mutants in P. syringae exhibit heightened bacitracin sensitivity, validating its role in resistance .

  • Recombinant UppP enables in vitro assays to screen inhibitors targeting cell wall synthesis .

4.2. Bacterial Genetics

  • Recombineering systems (e.g., RecTE Psy) in P. syringae leverage UppP’s metabolic role to optimize gene editing efficiency .

  • Homologous recombination studies highlight UppP’s conservation across Pseudomonas pathovars, aiding evolutionary analyses .

4.3. Biochemical Assays

  • Activity Measurement: Hydrolysis rates quantified via phosphate release assays using malachite green .

  • Substrate Specificity: Preferential activity toward C55-isoprenyl diphosphates .

Comparative Analysis

UppP orthologs vary in sequence length and host specificity:

SpeciesLength (aa)UniProt IDKey Difference
P. syringae pv. syringae276Q4ZS30Full-length, His-tagged for purification
Azospirillum brasilense187P39438Truncated C-terminal domain
E. coli260P0A916Structural characterization available

Technical Considerations

  • Reconstitution: Optimal solubility achieved in Tris/PBS buffer with 50% glycerol .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquot storage recommended .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve P. syringae UppP’s membrane topology.

  • Therapeutic Development: High-throughput screening of UppP inhibitors as novel antibiotics .

Recombinant UppP from P. syringae pv. syringae bridges molecular microbiology and antibiotic discovery, offering a tool to dissect bacterial resilience and innovate antimicrobial strategies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
uppP; Psyr_3008; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
uppP
Target Protein Sequence
MDLWTAAQALILGVVEGLTEFLPISSTGHQIIVADLIDFGGERAMAFNIIIQLGAILAVV WEFRRKILDVVVGLPKQQQAQRFTLNLLIAFMPAVVLGVIFADTIHHYLFNAITVATALV IGGVIMLWAERREHTVRTETVDDMSWSDALKIGLVQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRDMFRPDDFAVFAIGFVTSFIFAMIAVRGLLKF IATHSYAVFAWYRIAFGLLILATWQFGWIDWASAKA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas syringae and why is it significant for research?

Pseudomonas syringae is one of the most extensively studied plant pathogens, serving as a model organism for understanding bacterial pathogenicity, molecular mechanisms of plant-microbe interactions, and microbial ecology and epidemiology. The species comprises over 50 pathovars, each with distinct host plant specificity. Collectively, these pathovars infect nearly all economically important crop species, making P. syringae a significant threat to global agricultural production .

The significance of P. syringae as a research model stems from its well-characterized virulence mechanisms, including the type III secretion system (T3SS) encoded by hrp/hrc genes, which enables the bacterium to deliver effector proteins directly into plant cells . These features make P. syringae an excellent system for studying fundamental aspects of bacterial pathogenesis and host-pathogen interactions.

What is Undecaprenyl-diphosphatase (uppP) and what role does it play in Pseudomonas syringae?

Undecaprenyl-diphosphatase (uppP) is an essential enzyme involved in bacterial cell wall biosynthesis. It catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a critical carrier lipid required for peptidoglycan synthesis.

In Pseudomonas syringae, uppP plays a crucial role in maintaining cell wall integrity, which is essential for bacterial survival, growth, and pathogenicity. The enzyme is part of the peptidoglycan recycling pathway that ensures proper cell envelope biogenesis during bacterial growth and division. Disruption of uppP function typically leads to compromised cell wall integrity and decreased bacterial fitness .

How does the structure of uppP relate to its function in bacterial cell wall synthesis?

The structure of undecaprenyl-diphosphatase features a hydrophobic cleft that accommodates the lipid substrate and contains a P-loop motif at the entrance of this cleft, which is critical for binding the phosphate groups of the substrate. This structural arrangement allows the enzyme to position the diphosphate group of undecaprenyl diphosphate for nucleophilic attack, facilitating the removal of one phosphate group .

The enzyme belongs to a distinct protein fold family that differs from the "isoprenoid synthase fold" commonly associated with enzymes involved in isoprenoid biosynthesis. The conserved amino acid residues among related enzymes are strategically positioned around the hydrophobic cleft, forming the catalytic site responsible for the dephosphorylation reaction .

How should I design experiments to characterize the enzymatic activity of recombinant P. syringae uppP?

When designing experiments to characterize the enzymatic activity of recombinant P. syringae uppP, implement a systematic approach that incorporates the following elements:

  • Define your variables clearly:

    • Independent variable: Substrate concentration, pH, temperature, or potential inhibitors

    • Dependent variable: Rate of phosphate release or undecaprenyl phosphate formation

    • Control variables: Buffer composition, enzyme concentration, incubation time

  • Develop a specific, testable hypothesis about uppP activity under various conditions

  • Design appropriate enzyme assays:

    • Spectrophotometric assays measuring phosphate release

    • Radiometric assays using labeled substrates

    • HPLC-based methods to measure product formation

  • Include appropriate controls:

Control TypePurposeImplementation
Negative ControlEnsure observed activity is enzyme-specificReaction mixture without enzyme or with heat-inactivated enzyme
Positive ControlValidate assay functionalityKnown phosphatase with established activity
Internal ControlMonitor assay consistencyStandard curve of product or substrate
  • Implement a systematic variation of reaction conditions to determine optimal activity parameters (pH, temperature, ionic strength)

What methods are available for heterologous expression of P. syringae uppP?

For heterologous expression of P. syringae uppP, several expression systems are available, each with distinct advantages:

  • E. coli-based expression systems:

    • pET vector series with T7 promoter for high-level expression

    • pBAD vectors for tightly regulated arabinose-inducible expression

    • Cold-shock expression systems for improved protein folding

  • Purification strategy design:

    • Incorporate affinity tags (His6, GST, MBP) to facilitate purification

    • Consider tag position (N- or C-terminal) based on predicted protein structure

    • Include TEV or thrombin cleavage sites for tag removal if necessary

  • Optimization of expression conditions:

    • Temperature modulation (typically 16-30°C) to enhance soluble expression

    • Induction timing and inducer concentration optimization

    • Co-expression with chaperones if misfolding occurs

  • Membrane protein considerations:

    • Since uppP is likely membrane-associated, consider using specialized strains (C41/C43)

    • Evaluate detergents for extraction (LDAO, DDM, OG)

    • Explore fusion partners that enhance membrane protein expression (Mistic, SUMO)

How can I design gene deletion or mutation studies for P. syringae uppP?

To design effective gene deletion or mutation studies for P. syringae uppP, follow this methodological approach:

  • Allelic exchange strategy:

    • Amplify the gene of interest (uppP) with 3-4 kb of flanking DNA on each side using high-fidelity polymerase

    • Clone the amplicon into an entry vector (such as pENTR/D-TOPO)

    • Transfer to a Pseudomonas suicide vector (such as pLVC-D) using recombination-based methods

  • Recombineering approach:

    • Transform the construct into a recombineering strain like E. coli SW105

    • Utilize the temperature-regulated Red recombinase system (15-minute heat shock at 42°C)

    • Generate precise mutations or deletions within the uppP gene

  • Selection and screening strategy:

    • Incorporate appropriate antibiotic resistance markers

    • Design PCR screening primers spanning the expected modification site

    • Verify modifications by sequencing

  • Phenotypic validation:

    • Assess growth rates under various conditions

    • Evaluate cell morphology and division patterns

    • Measure sensitivity to cell wall-targeting antibiotics

    • Analyze pathogenicity in plant infection models

How does uppP in P. syringae contribute to bacterial virulence and plant infection?

The role of uppP in P. syringae virulence is multifaceted due to its central function in cell wall biosynthesis, which affects multiple aspects of bacterial pathogenicity:

  • Maintenance of cell envelope integrity:

    • UppP activity ensures proper peptidoglycan synthesis, which is critical for bacterial survival during plant colonization and infection

    • The cell envelope serves as a protective barrier against plant defense compounds

  • Contribution to the pathogenicity island function:

    • P. syringae contains a Hrp pathogenicity island with a tripartite structure that includes conserved genes essential for type III secretion system (T3SS) function

    • Cell wall integrity maintained by uppP is necessary for proper assembly and function of the T3SS apparatus that delivers virulence effectors into plant cells

  • Stress response during infection:

    • UppP activity may be modulated during infection in response to plant-derived antimicrobial compounds

    • Proper cell wall recycling through uppP function helps bacteria adapt to changing environments within the plant apoplast

  • Biofilm formation and persistence:

    • Cell envelope components regulated by uppP activity contribute to bacterial adhesion and biofilm formation

    • These structures enhance bacterial persistence in the phyllosphere and within plant tissues

What is the relationship between uppP activity and antibiotic resistance in P. syringae?

The relationship between uppP activity and antibiotic resistance in P. syringae involves several interconnected mechanisms:

  • Modulation of cell wall permeability:

    • UppP activity affects peptidoglycan density and composition

    • Changes in cell wall structure can alter permeability to antibiotics, particularly those targeting cell wall biosynthesis

  • Undecaprenyl phosphate recycling:

    • Efficient uppP function ensures rapid recycling of undecaprenyl phosphate carriers

    • This recycling pathway is crucial for maintaining peptidoglycan synthesis in the presence of antibiotics that target specific steps in cell wall assembly

  • Interaction with resistance mechanisms:

Antibiotic ClassResistance Mechanism Involving uppPEffect of uppP Modulation
β-lactamsAltered peptidoglycan cross-linkingIncreased uppP activity may enhance cell wall repair
GlycopeptidesModified peptidoglycan precursorsUppP activity ensures continued carrier lipid cycling
LipopeptidesMembrane composition changesUppP function affects lipid distribution in the membrane
  • Biofilm contribution to resistance:

    • UppP-dependent cell wall integrity supports biofilm formation

    • Biofilms provide physical barriers against antibiotic penetration and create microenvironments that reduce antibiotic efficacy

How do environmental conditions affect uppP expression and activity in P. syringae during plant colonization?

Environmental conditions substantially influence uppP expression and activity in P. syringae during the plant colonization process:

  • Temperature fluctuations:

    • P. syringae must adapt to varying temperatures in the phyllosphere

    • UppP expression may be thermoregulated to maintain appropriate cell wall integrity across temperature ranges encountered during infection

  • Humidity and water availability:

    • P. syringae infection is profoundly influenced by humidity conditions

    • UppP activity may be modulated to adjust cell wall properties in response to osmotic stress during wet-dry cycles on leaf surfaces

  • Nutrient availability:

    • Nutrient limitation in the apoplast may trigger stress responses

    • UppP expression could be integrated with global stress response networks to prioritize cell wall maintenance under nutrient-limited conditions

  • Plant defense responses:

    • Antimicrobial compounds produced by plants during defense responses target bacterial cell integrity

    • UppP activity may be upregulated to counter the effects of plant-derived antimicrobials on cell wall synthesis

How should I analyze data that contradicts my hypothesis about P. syringae uppP function?

When facing data that contradicts your hypothesis about P. syringae uppP function, follow this systematic approach:

What bioinformatic approaches can help predict the structure and function of P. syringae uppP?

To predict the structure and function of P. syringae uppP, employ these bioinformatic approaches:

  • Sequence analysis:

    • Multiple sequence alignment with characterized bacterial phosphatases

    • Identification of conserved motifs, particularly the P-loop motif critical for phosphate binding

    • Phylogenetic analysis to establish evolutionary relationships with functionally characterized homologs

  • Structural prediction:

    • Homology modeling based on crystal structures of related enzymes

    • Ab initio modeling for regions lacking homology to known structures

    • Molecular dynamics simulations to predict conformational flexibility

  • Functional domain analysis:

    • Identification of transmembrane domains and membrane association regions

    • Prediction of catalytic residues based on conserved motifs

    • Analysis of potential protein-protein interaction sites

  • Systems biology integration:

    • Prediction of regulatory networks controlling uppP expression

    • Metabolic pathway analysis to understand the context of uppP function

    • Gene neighborhood analysis to identify functionally related genes

What are common challenges in purifying active recombinant P. syringae uppP and how can they be addressed?

Purifying active recombinant P. syringae uppP presents several challenges that can be systematically addressed:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoter systems (T7, tac, araBAD)

    • Evaluate various expression hosts (BL21(DE3), C41/C43, Rosetta)

  • Protein insolubility:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use solubility tags (MBP, SUMO, TrxA)

  • Membrane protein extraction:

DetergentCritical Micelle Concentration (CMC)Optimal ConcentrationBest For
DDM0.17 mM0.5-1%Gentle extraction with preserved activity
LDAO1-2 mM0.5-2%Efficient extraction but potential denaturation
Digitonin0.5 mM0.5-1%Preserving protein-protein interactions
  • Loss of activity during purification:

    • Include glycerol (10-20%) in all buffers

    • Add reducing agents (DTT, β-mercaptoethanol) to prevent oxidation

    • Maintain proper pH (typically 7.0-8.0) throughout purification

    • Incorporate stabilizing agents like specific lipids or substrate analogs

  • Inconsistent enzymatic assays:

    • Standardize protein concentration determination methods

    • Ensure complete detergent removal before activity assays if detergent interferes

    • Develop robust activity assays with proper controls and standard curves

How can I optimize the expression of functional recombinant P. syringae uppP?

To optimize the expression of functional recombinant P. syringae uppP, implement this comprehensive strategy:

  • Vector design optimization:

    • Select vectors with appropriate promoters (strength and inducibility)

    • Include optimal ribosome binding sites for efficient translation

    • Consider adding purification tags that enhance solubility (MBP, SUMO)

  • Expression host selection:

    • For toxic membrane proteins, use specialized strains like C41/C43(DE3)

    • For proteins with rare codons, use Rosetta or CodonPlus strains

    • Consider non-E. coli hosts like Pseudomonas species for native-like membrane environment

  • Culture condition optimization:

    • Test different media formulations (LB, TB, autoinduction media)

    • Evaluate various temperatures (16°C, 25°C, 30°C, 37°C)

    • Optimize induction parameters (OD at induction, inducer concentration, duration)

  • Protein folding enhancement:

    • Include chemical chaperones in growth media (glycerol, sorbitol, TMAO)

    • Co-express with molecular chaperones specific for membrane proteins

    • Consider slow expression strategies (low temperature, weak promoters)

  • Systematic optimization approach:

    • Implement a Design of Experiments (DoE) approach to efficiently test multiple parameters

    • Use statistical analysis to identify significant factors affecting expression

    • Develop a standardized protocol based on optimized conditions

What are promising research directions for understanding the role of uppP in P. syringae virulence strategies?

Future research on uppP in P. syringae virulence should explore these promising directions:

  • Integration with virulence regulatory networks:

    • Investigate how uppP expression is coordinated with T3SS assembly and function

    • Examine potential co-regulation with genes in the Hrp pathogenicity island

    • Map the regulatory networks that connect cell wall synthesis with virulence factor expression

  • Structure-function relationships:

    • Determine the crystal structure of P. syringae uppP to identify unique features

    • Compare with structures from non-pathogenic bacteria to identify pathogen-specific adaptations

    • Use structure-guided mutagenesis to create separation-of-function mutants

  • Host-pathogen interaction dynamics:

    • Investigate how plant defense responses affect uppP activity

    • Examine temporal changes in uppP expression during different infection stages

    • Develop tools to visualize undecaprenyl phosphate cycling during infection in planta

  • Potential as a therapeutic target:

    • Design specific inhibitors targeting unique features of P. syringae uppP

    • Evaluate plant-derived compounds that might naturally target uppP function

    • Assess the efficacy of uppP inhibitors in controlling bacterial growth in plants

  • Systems biology approach:

    • Develop comprehensive models of cell wall biosynthesis in P. syringae

    • Integrate transcriptomic, proteomic, and metabolomic data to understand uppP function in context

    • Examine potential moonlighting functions of uppP beyond its enzymatic role

How might comparative genomics inform our understanding of uppP evolution in different P. syringae pathovars?

Comparative genomics offers valuable insights into uppP evolution across P. syringae pathovars:

  • Evolutionary conservation and divergence:

    • Analyze sequence conservation of uppP genes across the ~50 pathovars of P. syringae

    • Identify pathovar-specific modifications that might correlate with host specificity

    • Compare uppP gene neighborhoods to detect horizontal gene transfer events

  • Selection pressure analysis:

    • Calculate Ka/Ks ratios to determine if uppP is under positive, purifying, or neutral selection

    • Identify specific amino acid positions under selection pressure

    • Correlate evolutionary patterns with pathogenicity and host range

  • Structural variability impact:

    • Model protein structures from divergent pathovars to predict functional differences

    • Identify structural features that might influence substrate specificity or regulatory interactions

    • Correlate structural predictions with experimental phenotypic differences

  • Genomic context analysis:

    • Compare the genomic location of uppP relative to pathogenicity islands like the tripartite Hrp Pai

    • Identify potential horizontal gene transfer events that might have influenced uppP evolution

    • Examine synteny of genes surrounding uppP to identify co-evolved functional modules

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.