Recombinant Pseudomonas syringae pv. syringae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas syringae pv. syringae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC)

Recombinant Pseudomonas syringae pv. syringae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) is an enzyme that belongs to the glycosyltransferase family, specifically involved in the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate . This transfer is a crucial step in modifying lipid A, a component required for resistance against polymyxin and cationic antimicrobial peptides . ArnC is vital for synthesizing the common polysaccharide antigen (CPA) in Pseudomonas aeruginosa . The enzyme uses a phosphate-undecaprenol intermediate to initiate the synthesis of O-specific antigen (OSA) and CPA .

Biological Significance

ArnC plays a crucial role in bacterial resistance to antimicrobial compounds . By modifying lipid A with 4-deoxy-4-formamido-L-arabinose, bacteria can alter the charge of their cell surface, reducing the binding affinity of polymyxins and cationic antimicrobial peptides . In P. aeruginosa, ArnC is essential for the biosynthesis of CPA, a virulence factor that becomes increasingly important during the later stages of infection .

Research Findings and Applications

  1. Enzyme Activity and Specificity: Studies have demonstrated that ArnC exhibits specificity for UDP-4-deoxy-4-formamido-L-arabinose and undecaprenyl phosphate . It catalyzes the transfer of the sugar moiety to the lipid carrier, forming undecaprenyl-phosphate-4-deoxy-4-formamido-L-arabinose .

  2. Role in Virulence: Research indicates that the expression of ArnC and the subsequent modification of lipid A contribute to the virulence of Pseudomonas aeruginosa . Mutants lacking ArnC are more susceptible to killing by polymyxins and exhibit reduced virulence in animal models .

  3. Potential Drug Target: Given its role in bacterial resistance and virulence, ArnC has been identified as a potential target for developing novel antibacterial agents. Inhibitors of ArnC could compromise bacterial cell surface integrity and increase susceptibility to existing antibiotics .

  4. Glycosyltransferase Activity: ArnC is involved in synthesizing bacterial polysaccharides and modifying lipopolysaccharides, which are vital for bacterial structure and function . ArnC facilitates the transfer of a sugar nucleotide to a lipid anchor, a critical step in synthesizing bacterial cell surface structures .

  5. Resistance to Antimicrobial Peptides: The enzyme contributes to bacterial resistance against antimicrobial peptides and polymyxins . ArnC modifies lipid A, reducing the binding affinity of antimicrobial peptides and polymyxins, thus protecting the bacterial cell .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
arnC; Psyr_2690; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Pseudomonas syringae pv. syringae (strain B728a)
Target Names
arnC
Target Protein Sequence
MKPYPIKFVSIVIPVYNERQSLPELLRRTEAACEQLDHRFEIVLVDDGSRDDSTDILQRA AERADSPFVAVILNRNYGQHAAIMAGFEQCQGDVVITLDADLQNPPEEIPRLVKLAEQGY DVVGTVRSNRQDSAWRRWPSKLINLAVQRSTGVAMNDYGCMLRAYRRTIVDAMLACRERS TFIPILANSFARHTTEVLVDHAEREHGDSKYSPMRLINLMFDLITCMTTTPLRLLSIIGF SMALLGVLFAALLIVLRLIFGASWAGDGMFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD VRARPRFFIEKIVRSSSPVATDSIDSSVTPYMNKVAP
Uniprot No.

Target Background

Function

This protein catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A and is essential for bacterial resistance to polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase in Pseudomonas syringae?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (also known as Ara4FN transferase) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This enzyme plays a crucial role in modifying bacterial cell surface components, particularly lipid A. The modified arabinose attachment to lipid A contributes significantly to bacterial resistance against polymyxin antibiotics and various cationic antimicrobial peptides, representing a key bacterial defense mechanism .

When investigating this enzyme in Pseudomonas syringae, researchers should implement comparative genomics approaches to identify functional homologs of arnC genes previously characterized in other species like Escherichia coli. Functional characterization requires expressing the recombinant enzyme, followed by in vitro activity assays measuring the transfer of the arabinose moiety using techniques such as thin-layer chromatography or mass spectrometry to detect the modified undecaprenyl phosphate product.

How does the arnC gene differ between Pseudomonas syringae and other bacterial species?

The arnC gene in Pseudomonas syringae shares functional similarity with homologs in other bacterial species but exhibits distinct genetic characteristics that reflect its adaptation to plant-associated lifestyles. While the basic catalytic function remains conserved across species—catalyzing the transfer of 4-deoxy-4-formamido-L-arabinose—sequence analysis reveals evolutionary adaptations unique to Pseudomonas lineages .

To properly analyze these differences, researchers should:

  • Perform comprehensive phylogenetic analyses of arnC sequences across bacterial species

  • Identify conserved catalytic domains and species-specific variations

  • Evaluate codon usage patterns and regulatory elements

  • Correlate sequence differences with ecological niches (plant pathogens vs. other habitats)

The E. coli arnC homolog (encoding EC 2.4.2.53) shows specific activity patterns, including no activity with UDP-4-amino-4-deoxy-beta-L-arabinose . Comparative enzymatic assays between recombinant P. syringae arnC and homologs from other species should be conducted under standardized conditions to quantify kinetic differences and substrate preferences.

What role does Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase play in Pseudomonas syringae pathogenicity?

Within the context of Pseudomonas syringae pathogenicity, Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase contributes to bacterial survival during host-pathogen interactions. P. syringae employs two principal virulence strategies: suppression of host immunity and creation of an aqueous apoplast environment . The modification of lipid A via arnC activity enhances resistance to host antimicrobial peptides encountered during plant infection.

Methodologically, researchers investigating this relationship should:

  • Generate arnC knockout mutants using recombineering approaches with the P. syringae RecTE homologs

  • Assess mutant virulence in planta through infection assays measuring bacterial growth curves and disease symptom development

  • Quantify susceptibility to plant antimicrobial peptides using minimum inhibitory concentration (MIC) assays

  • Compare lipid A profiles between wild-type and ΔarnC strains using mass spectrometry

These approaches will establish the specific contribution of arnC to virulence, building upon known P. syringae virulence factors that include the T-PAI, ice nucleation proteins, auxin synthesis/inactivation enzymes, and exopolysaccharides like alginate .

What are the optimal conditions for recombinant expression of Pseudomonas syringae arnC?

Successful recombinant expression of P. syringae arnC requires careful optimization of multiple experimental parameters. Based on established protocols for membrane-associated bacterial transferases, researchers should systematically evaluate:

  • Expression systems: Compare E. coli BL21(DE3), C41(DE3), and C43(DE3) strains specifically engineered for membrane protein expression

  • Expression vectors: Test T7-based vectors with varying promoter strengths and fusion tags (His6, MBP, SUMO) for improved solubility

  • Induction parameters: Optimize IPTG concentration (0.1-1.0 mM), temperature (16-30°C), and duration (4-24 hours)

  • Media composition: Evaluate standard LB versus enriched media (2XYT, TB) and minimal media for isotopic labeling

The enzyme contains transmembrane regions similar to those identified in the E. coli homolog, which shows a sequence containing membrane-spanning domains . These hydrophobic regions present particular challenges for recombinant expression, often requiring detergent solubilization using n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) during purification.

Expression trials should be analyzed via Western blotting and activity assays to determine both protein yield and functional status of the recombinant enzyme.

How can the RecTE recombineering system be optimized for targeted arnC modifications in Pseudomonas syringae?

The RecTE recombineering system from Pseudomonas syringae offers a powerful approach for precise genomic modifications of the arnC gene. Optimization of this system requires understanding several key factors:

  • RecT from P. syringae alone is sufficient for single-stranded DNA oligonucleotide recombination, while both RecT and RecE are required for efficient double-stranded DNA recombination

  • Expression vectors containing P. syringae RecT (recTPsy) and RecTE (recTEPsy) genes should be constructed with appropriate promoters to control expression levels

  • The sacB counterselection system facilitates plasmid elimination post-recombination

To achieve maximum recombination efficiency when targeting arnC, researchers should:

ParameterOptimization RangeNotes
DNA substrate length50-100 nt (ssDNA), 500-2000 bp (dsDNA)Homology arms of 40-50 bp each
DNA concentration100-500 ng (ssDNA), 500-1000 ng (dsDNA)Higher concentrations may be toxic
Recovery mediaSOC, PS mediumAdd 1 mM MgSO₄ to enhance recovery
Recovery time2-6 hoursBefore selective plating
Recombinase expression0.1-1.0% arabinoseFor arabinose-inducible promoters

Researchers should quantitatively assess recombination frequencies using selective markers and PCR verification to identify the optimal conditions specific to arnC modifications in their P. syringae strain .

What structural features of Pseudomonas syringae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase determine substrate specificity?

The structural basis for substrate specificity in P. syringae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase requires sophisticated structural biology approaches. Based on related transferases, key methodological considerations include:

  • Homology modeling using related crystal structures coupled with molecular dynamics simulations

  • Site-directed mutagenesis of predicted catalytic residues to confirm their functional roles

  • Substrate docking simulations to predict binding modes of UDP-4-deoxy-4-formamido-L-arabinose

  • Crystallization trials of the purified enzyme with substrate analogs or inhibitors

The enzyme shows remarkable specificity, as demonstrated by the lack of activity with UDP-4-amino-4-deoxy-beta-L-arabinose in homologous systems . This selectivity likely stems from precise recognition of the formamido group through specific hydrogen bonding networks within the active site.

Researchers should perform enzymatic assays using a panel of substrate analogs with systematic modifications to map the structural requirements for activity. Kinetic parameters (Km, kcat, kcat/Km) should be determined for each viable substrate to quantify the energetic contributions of specific molecular interactions.

What are the most effective approaches for detecting and quantifying Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase activity?

Detecting and quantifying the enzymatic activity of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase requires specialized analytical techniques due to the lipid-based substrate and product. Researchers should consider these methodological approaches:

  • Radioisotope-based assays: Using ³²P-labeled UDP or ¹⁴C-labeled arabinose substrates to track product formation

  • LC-MS/MS analysis: For label-free detection of undecaprenyl phosphate-arabinose products

  • Coupled enzyme assays: Measuring UDP release using auxiliary enzymes like pyruvate kinase and lactate dehydrogenase with spectrophotometric detection of NADH oxidation

  • TLC-based separation: For rapid analysis of reaction products following extraction into organic solvents

The basic reaction catalyzed can be represented as:

UDP-4-deoxy-4-formamido-β-L-arabinopyranose + ditrans,octacis-undecaprenyl phosphate → UDP + 4-deoxy-4-formamido-α-L-arabinopyranosyl ditrans,octacis-undecaprenyl phosphate

When establishing assay conditions, researchers should carefully optimize buffer components (pH 7.0-8.0, divalent cations like Mg²⁺ or Mn²⁺), detergent concentrations (to maintain substrate solubility), and incubation times to ensure linear reaction rates within the enzyme's stability window.

How can researchers effectively isolate and purify lipid A modified by arnC activity from Pseudomonas syringae?

Isolation and purification of arnC-modified lipid A from Pseudomonas syringae requires a methodical approach to preserve the native structure while achieving sufficient purity for analysis:

  • Bacterial culture preparation:

    • Grow P. syringae cultures under conditions that induce arnC expression (typically low Mg²⁺ or mild acidic pH)

    • Compare wild-type strains with arnC overexpression and knockout strains

  • Lipid A extraction protocol:

    • Harvest bacterial cells at late logarithmic phase (OD₆₀₀ = 0.8-1.0)

    • Wash cells with phosphate buffer to remove media components

    • Extract using the Bligh-Dyer method with chloroform:methanol:water (1:2:0.8, v/v/v)

    • Hydrolyze with mild acid (1% acetic acid, 100°C, 1 hour) to cleave the lipid A from core oligosaccharides

    • Centrifuge to separate phases and collect the organic layer containing lipid A

  • Purification techniques:

    • HPLC separation using a C18 reverse-phase column with a methanol/chloroform/water gradient

    • Solid-phase extraction using silica columns with increasing methanol in chloroform

  • Analytical methods:

    • MALDI-TOF mass spectrometry to confirm 4-deoxy-4-formamido-L-arabinose modification

    • NMR spectroscopy for structural verification of the arabinose linkage

Researchers should implement internal standards and recovery controls to account for extraction efficiency variations between different bacterial strains or growth conditions.

What considerations are important when designing primers for arnC amplification and cloning from Pseudomonas syringae?

Effective primer design for arnC amplification and cloning from Pseudomonas syringae requires attention to several critical factors:

  • Sequence analysis considerations:

    • Analyze GC content of the P. syringae arnC gene (typically higher than E. coli homologs)

    • Identify and avoid repetitive sequences or secondary structure-forming regions

    • Check for internal restriction sites that might interfere with cloning strategies

  • Primer design parameters:

    • Design primers with 18-25 nucleotides complementary to the target sequence

    • Maintain GC content between 40-60% where possible

    • Ensure similar melting temperatures (Tm) for forward and reverse primers (within 5°C)

    • Add restriction enzyme sites with 3-6 nucleotide overhangs at 5' ends

    • Include Kozak sequences or ribosome binding sites for expression constructs

  • Optimization strategies:

    • Use touchdown PCR protocols to improve specificity

    • Test gradient PCR to identify optimal annealing temperatures

    • Add DMSO (2-5%) or betaine (1M) to reduce secondary structure formation

    • Select high-fidelity polymerases (Q5, Phusion) for accurate amplification

  • Validation methods:

    • Perform sequencing of PCR products to confirm correct amplification

    • Verify expression constructs by restriction digestion and sequencing

    • Test expression using small-scale induction before proceeding to large-scale purification

Similar approaches have been successfully used for amplifying and cloning recombineering genes (recT and recTE) from P. syringae pv. syringae B728a , providing a methodological framework adaptable to arnC.

How can contradictory results in arnC functional studies be reconciled?

When encountering contradictory results in arnC functional studies, researchers should implement a systematic approach to identify and resolve discrepancies:

  • Analytical framework for contradiction resolution:

    • Catalog all experimental conditions across contradictory studies (strain backgrounds, growth conditions, assay methods)

    • Identify key variables that differ between studies (temperature, pH, media composition, detection methods)

    • Design controlled experiments that systematically test each variable independently

  • Common sources of contradictions and their resolution:

    • Strain-specific effects: Sequence arnC from each strain to identify polymorphisms

    • Growth phase dependencies: Compare activity at early logarithmic, late logarithmic, and stationary phases

    • Substrate preparation inconsistencies: Standardize substrate synthesis or source

    • Analytical technique differences: Cross-validate using multiple detection methods

In published literature, even the EC number assignment for Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase shows discrepancies (EC 2.4.2.53 vs. EC 2.7.8.30) , suggesting potential confusion about the precise catalytic mechanism or reaction classification. Researchers should explicitly define the reaction being studied and cross-reference multiple enzyme databases when interpreting results.

What statistical approaches are most appropriate for analyzing recombineering efficiency when modifying the arnC gene?

When analyzing recombineering efficiency for arnC gene modifications, researchers should employ robust statistical methods that account for the stochastic nature of recombination events:

  • Experimental design considerations:

    • Include multiple biological replicates (minimum n=3)

    • Perform technical replicates for each biological sample

    • Include appropriate positive controls (known high-efficiency targets) and negative controls

    • Normalize to transformation efficiency using a standard plasmid

  • Statistical analysis framework:

    • Calculate recombination frequency as (number of recombinants)/(total viable cells)

    • Apply logarithmic transformation to normalize recombination frequency data

    • Use ANOVA with post-hoc tests (Tukey's HSD) for comparing multiple conditions

    • Implement non-parametric alternatives (Kruskal-Wallis) when data do not meet normality assumptions

  • Advanced analysis approaches:

    • Develop regression models to identify predictors of recombination efficiency

    • Calculate 95% confidence intervals for comparing different experimental conditions

    • Use generalized linear models with appropriate error distributions for recombination event counts

The recombineering efficiency using RecTE from P. syringae can be quantitatively assessed and compared across different DNA substrate designs and experimental conditions . Researchers should report both the mean recombination frequency and measures of variation (standard deviation or standard error) for complete statistical interpretation.

How can researchers distinguish between arnC-specific phenotypes and pleiotropic effects in Pseudomonas syringae mutants?

Distinguishing arnC-specific phenotypes from pleiotropic effects requires methodical experimental design and careful controls:

  • Genetic complementation strategy:

    • Create clean deletion mutants using markerless approaches

    • Complement with wild-type arnC expressed from its native promoter at a neutral chromosomal site

    • Create point mutations in catalytic residues to separate protein presence from enzymatic activity

    • Use inducible promoters to create expression gradients for dose-response analysis

  • Phenotypic analysis framework:

    • Perform comprehensive phenotyping (growth rates, biofilm formation, motility, virulence)

    • Quantify lipid A modification directly using mass spectrometry

    • Assess polymyxin and antimicrobial peptide resistance profiles

    • Measure expression of known stress response genes to identify compensatory mechanisms

  • Multi-omics approach:

    • Compare transcriptomes of wild-type, ΔarnC, and complemented strains

    • Perform untargeted metabolomics to identify metabolic perturbations

    • Use phospholipid profiling to assess membrane composition changes

    • Conduct protein-protein interaction studies to identify functional partnerships

  • Statistical validation:

    • Apply principal component analysis to separate arnC-specific effects from general stress responses

    • Use hierarchical clustering of multi-omics data to identify distinct phenotypic signatures

    • Implement ANOVA with multiple testing correction for large-scale data analysis

By implementing these approaches, researchers can confidently attribute observed phenotypes directly to arnC function rather than to secondary effects, positioning arnC within the broader context of P. syringae virulence mechanisms that include T3SS effectors, exopolysaccharides, and phytotoxins .

What emerging technologies could enhance our understanding of arnC function in Pseudomonas syringae?

Several cutting-edge technologies offer promising approaches to expand our understanding of arnC function in Pseudomonas syringae:

  • CRISPR-Cas technologies:

    • Implement CRISPRi for tunable repression of arnC expression

    • Use base editors for precise point mutations in catalytic residues

    • Apply CRISPR-Cas9 genome editing combined with recombineering for scarless mutations

    • Develop CRISPR activation systems to upregulate arnC under native regulation

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to visualize ArnC protein localization

    • Use fluorescent D-amino acids to track cell wall modifications

    • Implement FRET-based biosensors to monitor enzyme activity in vivo

    • Develop correlative light and electron microscopy approaches for structural context

  • Synthetic biology approaches:

    • Create orthogonal expression systems for arnC with non-native substrates

    • Engineer substrate analogs with bioorthogonal handles for click chemistry

    • Design genetic circuits to control arnC expression in response to specific stimuli

    • Develop cell-free expression systems for high-throughput enzyme variant screening

  • Computational methods:

    • Apply machine learning to predict structural features from sequence data

    • Use molecular dynamics simulations to model substrate binding and catalysis

    • Implement metabolic modeling to predict system-wide effects of arnC perturbation

    • Develop evolutionary algorithms to trace the acquisition and modification of arnC genes

These technologies can be integrated with established recombineering approaches to achieve unprecedented precision in manipulating and analyzing arnC function in P. syringae.

How might the study of arnC contribute to developing novel antimicrobial strategies against Pseudomonas syringae?

The study of arnC offers several promising avenues for developing novel antimicrobial strategies against Pseudomonas syringae:

  • Structure-based inhibitor design:

    • Identify the catalytic pocket of ArnC through structural studies

    • Design competitive inhibitors targeting the UDP-arabinose binding site

    • Develop transition state analogs for high-affinity enzyme inhibition

    • Create covalent inhibitors targeting conserved active site residues

  • Combination therapy approaches:

    • Pair ArnC inhibitors with existing antimicrobial peptides

    • Target multiple steps in the lipid A modification pathway

    • Combine with biofilm dispersal agents to enhance efficacy

    • Develop adjuvants that sensitize bacteria to plant defense molecules

  • Resistance-breaking strategies:

    • Identify epistatic interactions between arnC and other resistance mechanisms

    • Design molecules that specifically target arnC-modified lipid A

    • Develop strategies to prevent compensatory mechanisms

    • Create hypersensitivity scenarios through synthetic lethality

  • Agricultural applications:

    • Develop seed treatments containing ArnC inhibitors

    • Create transgenic plants expressing inhibitors in response to infection

    • Design protective formulations for foliar application

    • Implement soil amendments that trigger plant resistance mechanisms

By targeting arnC and its role in antimicrobial peptide resistance, researchers can potentially disrupt a key defense mechanism of P. syringae, enhancing bacterial susceptibility to both plant-derived antimicrobial compounds and agricultural control agents. This approach aligns with the broader understanding of P. syringae pathogenicity mechanisms and host adaptation strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.