Recombinant Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752 (Psyr_3752)
Description
Product Overview
Recombinant Full Length Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752(Psyr_3752) Protein, His-Tagged, is a protein with the following characteristics :
-
Product Overview: Recombinant Full Length Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752(Psyr_3752) Protein (Q4ZPY9) (1-110aa), fused to N-terminal His tag, was expressed in E. coli .
-
AA Sequence: MLNYLWFFLAALFEIFGCYAFWLWLRQGKSALWVIPALVSLTVFALLLTRVEAAYAGRAY AAYGGIYIVASIAWLGLVERVRPLGTDWLGLAFCVIGATIILLGPRWSAA
-
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .
-
Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
-
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as a reference .
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment based on your needs.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Target Background
KEGG: psb:Psyr_3752
STRING: 205918.Psyr_3752
Q&A
Basic Research Questions
-
What is Pseudomonas syringae pv. syringae UPF0060 membrane protein Psyr_3752?
Psyr_3752 is an integral membrane protein belonging to the UPF0060 family, derived from the plant pathogenic bacterium Pseudomonas syringae pv. syringae (strain B728a). The protein consists of 110 amino acids with a molecular mass of approximately 12.2 kDa. As an integral membrane protein, it is permanently attached to the biological membrane, making it distinct from peripheral membrane proteins that associate temporarily with cellular membranes. The UPF0060 designation indicates it is a protein of unknown function, with potential roles in membrane integrity, transport, or signaling mechanisms .
-
What are the recommended storage conditions for recombinant Psyr_3752?
For optimal stability and activity of recombinant Psyr_3752, the following storage conditions are recommended:
-
Storage buffer: Tris-based buffer with 50% glycerol, optimized for this specific protein
-
Standard storage temperature: -20°C
-
Long-term storage: -80°C is recommended for extended periods
-
Working solutions: Store at 4°C for up to one week
-
Important note: Repeated freezing and thawing should be avoided as it can compromise protein integrity
These conditions help maintain the native conformation and functional properties of the protein while preventing degradation over time.
-
-
How does Psyr_3752 relate to other membrane proteins in Pseudomonas species?
Psyr_3752 belongs to the UPF0060 family of membrane proteins, which is distributed across various bacterial species. While distinct from well-characterized proteins like HrpZ, comparative analysis reveals some interesting parallels:
-
Unlike HrpZ, which functions in the type III secretion system and exhibits pore-forming activity in lipid membranes, Psyr_3752's specific function remains uncharacterized
-
Similar to other membrane proteins in Pseudomonas, it likely plays a role in membrane organization or cellular processes
-
Structural predictions suggest multiple transmembrane domains, common in integral membrane proteins that maintain membrane integrity or facilitate transport
Understanding these relationships provides context for functional hypotheses about Psyr_3752's role in bacterial physiology and potentially pathogenicity.
-
