Recombinant Pseudomonas syringae pv. tomato Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Functional Role

The lnt enzyme (EC 2.3.1.-) catalyzes the N-acylation of apolipoproteins, a process essential for bacterial lipid transport and membrane stability. Key characteristics include:

PropertyDetail
Uniprot IDQ87VX7
Sequence Length506 amino acids
Molecular WeightCalculated from AA sequence (not explicitly provided in sources)
FunctionTransfers acyl groups to apolipoproteins, enabling lipid-protein interactions
Gene Namelnt (Apolipoprotein N-acyltransferase)

The enzyme is expressed in E. coli as a recombinant protein, often with a tag (e.g., His-tag) for purification . Its activity is dependent on specific Tris-based buffers and glycerol for stability, with storage at -20°C recommended .

Recombinant Production and Applications

The recombinant production of lnt involves heterologous expression in E. coli, followed by purification and quality control.

Key Observations

  1. Lipid Modification Role:

    • N-acyltransferases like lnt modify apolipoproteins, which are involved in bacterial lipid transport and membrane integrity .

    • Dysregulation of such enzymes may impact bacterial virulence, as lipid metabolism is linked to pathogen survival in plant hosts .

  2. Diagnostic Potential:

    • Recombinant lnt is used in ELISA kits to detect immune responses to P. syringae infections, aiding in disease monitoring .

  3. Genetic Context:

    • The lnt gene (PSPTO_4808) is part of the P. syringae DC3000 genome, with homologs identified in other Pseudomonas species (e.g., P. aeruginosa) .

Comparative Analysis

Specieslnt FunctionKey Difference
P. syringae pv. tomatoN-acylation of apolipoproteinsHost-specific virulence factors
P. aeruginosaSimilar lipid modificationHis-tagged for structural studies

Gaps and Future Directions

  1. Mechanistic Studies:

    • Detailed biochemical assays to characterize substrate specificity and catalytic efficiency of P. syringae lnt are lacking.

  2. Pathogenicity Link:

    • No direct evidence links lnt to virulence in P. syringae pv. tomato; further studies are needed to explore its role in bacterial adaptation to plant hosts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
lnt; PSPTO_4808; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-506
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
lnt
Target Protein Sequence
MRWITRPGWPGNLLALAAGGLTTLALAPFDFWPLVLVSVAMFYLGLRELSPRQALARGWC YGFGLYGAGTSWIYVSIHTYGGASALLAGLLMLLFIAAIALFFALPAWVWARWLRRNEAP LADSLAFAALWLWQEAFRGWFLTGFPWLYSGYSQLDAPLAGLAPVGGVWLISFALGLTAA LLCNLHRLRARKSFLAMGVLLLLAPWVAGLALKDHAWTSPSGPPLKVAAMQGNIEQSMKW DPQKLNDQLALYRDMTFRSQQADLIVWPETAVPVLKESAEGYLSMMGKFAADRGAALITG VPVREPTGRGEYSYYNGITVTGQGDGTYFKQKLVPFGEYVPLQDLLRGLISFFDLPMSDF ARGPNDQALLQAKGYHIAPFICYEVVYPEFAAGLSAQSDLLLTVSNDTWFGTSIGPLQHL QMAQMRALEAGRWMIRATNNGVTALIDPFGRITVQIPQFERGVLYGEVVPMHELTPYLHW RSWPLAIVCLLLFGWALLAARISKTV
Uniprot No.

Target Background

Function

Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein; the final step in lipoprotein maturation.

Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) in Pseudomonas syringae pv. tomato?

Apolipoprotein N-acyltransferase (lnt) is an essential membrane enzyme involved in the final step of bacterial lipoprotein maturation. In Pseudomonas syringae pv. tomato (strain DC3000), lnt catalyzes a two-step reaction via a ping-pong mechanism, where it transfers an acyl group from membrane phospholipids to apolipoprotein substrates . The enzyme is embedded in the cytoplasmic membrane with a nitrilase-like catalytic domain containing the catalytic triad E267-K335-C387 located in the periplasm . This protein plays a critical role in bacterial membrane integrity and potentially in pathogenicity mechanisms.

What is the full amino acid sequence of recombinant P. syringae pv. tomato lnt?

The full amino acid sequence of Pseudomonas syringae pv. tomato (strain DC3000) Apolipoprotein N-acyltransferase is:

MRWITRPGWPGNLLALAAGGLTTLALAPFDFWPLVLVSVAMFYLGLRELSPRQALARGWCYGFGLYGTSWIYV
SIHTYGGASALLAGLLLLFIAAIALLALPAWVWARWLRRNEAPLADSLAFAALWLWQEAFRGWFLTGFPWLYS
GYSQLDAPLAGLAPVGGVWLISFALGLTAALLCNLHRLRARKSFLAMGVLLLLAPWVAGLALKDHAWTSPSGP
PLKVAAMQGNIEQSMKWDPQKLNDQLALYRDMTFRSQQADLIVWPETAVPVLKESAEGYLSMMGKFAADRGAA
LITGVPVREPTGRGEYSYYNGITVTGQGDGTYFKQKLVPFGEYVPLQDLLRGLISFFDLPMSDARGPNDQALL
QAKGYHIAPFICYEVVYPEFAAGLSAQSDLLLTVSNDTWFGTSIGPLQHLQMAQMRALEAGRWMIRATNNGVT
ALIDPFGRITVQIPQFERGVLYGEVVPMHELTPYLHWRSWPLAIVCLLLFGWALLAARISKTV

The protein consists of 506 amino acids and has a designated EC number of 2.3.1.- in the enzyme classification system .

What assays are available for measuring Pseudomonas syringae lnt activity?

Several methodologies have been developed to measure lnt activity:

  • Gel Mobility Shift Assay: This assay relies on the reduced mobility of small diacylglyceryl peptides on Tris-Tricine Urea SDS PAGE upon N-acylation . The mobility difference occurs because the addition of the N-acyl group changes the molecular weight and physicochemical properties of the peptide.

  • Fluorescence-based Assay: A more sensitive approach where the N-acyl peptide product is bound to streptavidin-coated plates after a click-chemistry reaction. The fluorescent signal serves as a direct read-out of the reaction, showing more than 5-fold enhancement in the presence of active enzyme compared to negative controls .

  • Coupled Enzymatic Reactions: These assays link lnt activity to other measurable enzymatic activities, providing an indirect but quantifiable measure of lnt function.

When designing experiments, researchers typically use heat-inactivated lnt as a negative control to ensure complete inactivation of both catalytic steps of the enzyme .

How can recombinant P. syringae lnt be effectively stored and handled?

For optimal stability and activity, recombinant Pseudomonas syringae pv. tomato Apolipoprotein N-acyltransferase should be stored in a Tris-based buffer with 50% glycerol . The recommended storage temperature is -20°C, and for extended storage, conservation at -80°C is advised .

For experimental work, the following handling practices are recommended:

  • Avoid repeated freezing and thawing cycles as this significantly reduces enzyme activity

  • Store working aliquots at 4°C for up to one week

  • When thawing frozen stocks, do so gradually on ice to prevent protein denaturation

  • Maintain sterile conditions to prevent microbial contamination

What expression systems are most suitable for producing recombinant P. syringae lnt?

The production of functional recombinant Pseudomonas syringae lnt presents challenges due to its nature as a membrane-bound enzyme with multiple transmembrane segments. Based on similar bacterial enzymes, successful expression strategies include:

  • E. coli Expression Systems: Using specialized strains optimized for membrane protein expression (C41, C43, or Lemo21) with temperature-inducible or IPTG-inducible promoters.

  • Affinity Tags Selection: The tag type should be determined during the production process to optimize protein folding and activity . Common options include:

    • N-terminal His6 tags (may affect signal peptide processing)

    • C-terminal His6 tags (minimizes interference with translocation)

    • Fusion partners like MBP to improve solubility

  • Extraction Methods: Gentle detergent extraction (typically using non-ionic detergents like DDM or LDAO) to maintain the native conformation of the protein during purification.

What is the catalytic mechanism of lnt in lipoprotein processing?

Apolipoprotein N-acyltransferase (lnt) catalyzes the final step in bacterial lipoprotein maturation through a two-step reaction mechanism:

  • First Step: Formation of a stable thioester acyl-enzyme intermediate upon hydrolysis of phospholipid. Lnt preferentially uses phospholipids with small polar headgroups, carrying a saturated fatty acid on sn-1 (C16:0) and a non-saturated fatty acid on sn-2 (C18:1) as acyl donors .

  • Second Step: Transfer of the acyl group from the enzyme intermediate to the α-amino group of the N-terminal cysteine residue of the apolipoprotein substrate.

The reaction follows a ping-pong mechanism with the catalytic triad E267-K335-C387 playing a critical role in the process . Structurally, the enzyme contains flexible loops that face away from the active site, likely facilitating substrate entry and exit during the catalytic cycle .

How does lnt activity contribute to P. syringae virulence?

While the search results don't directly address lnt's specific role in P. syringae virulence, we can draw on comparative research to understand its potential significance:

Mature lipoproteins are essential components of bacterial membranes and play various roles in bacterial physiology and pathogenicity. In Pseudomonas syringae, which causes numerous agronomically important crop diseases , properly processed lipoproteins likely contribute to virulence through several mechanisms:

  • Membrane Integrity: Properly processed lipoproteins maintain outer membrane structure, which is essential for bacterial survival during host colonization.

  • Immune Recognition/Evasion: Lipoproteins can serve as pathogen-associated molecular patterns (PAMPs) recognized by host immune systems. Modifications by lnt may affect this recognition.

  • Secretion System Function: Many virulence-associated secretion systems require properly processed membrane components to function.

Experimental evidence indicates that P. syringae virulence is type III secretion system-dependent , and proper membrane organization (which depends on lipoprotein processing) is crucial for type III secretion function.

How can machine learning approaches improve understanding of P. syringae virulence factors including lnt?

Machine learning approaches have demonstrated significant potential for predicting P. syringae virulence and host adaptation. Recent research has employed gradient boosting machine learning to predict strain virulence based on genomic data with high accuracy (mean absolute error = 0.05) . This approach could be extended to understand the specific contribution of lnt to virulence through:

  • Comparative Genomics: Analysis of lnt sequence variations across different P. syringae pathovars to identify correlations with host specificity and virulence.

  • Feature Importance Analysis: Machine learning models can identify the relative importance of lnt among other virulence factors by analyzing the contribution of lnt-related genomic features to virulence predictions.

  • Structural Variation Impact: By incorporating structural predictions of lnt variants into machine learning models, researchers could predict how specific mutations affect enzyme function and virulence.

The table below summarizes potential machine learning approaches for studying lnt in P. syringae:

What are the challenges in developing selective inhibitors of P. syringae lnt?

Developing selective inhibitors of P. syringae lnt presents several challenges that researchers must address:

  • Membrane Localization: The enzyme's active site is oriented toward the periplasmic space and embedded within transmembrane segments , making it difficult for inhibitory molecules to access the catalytic site.

  • Structural Conservation: The structural similarity between lnt from different bacterial species suggests potential off-target effects when developing inhibitors, requiring careful design for selectivity.

  • Two-Step Reaction Mechanism: The ping-pong reaction mechanism provides multiple points for inhibition (either the formation of the acyl-enzyme intermediate or the transfer to the apolipoprotein), requiring sophisticated assays to determine the inhibition mechanism.

  • Bioavailability Challenges: Effective inhibitors must penetrate both the outer membrane and cytoplasmic membrane of gram-negative bacteria to reach the periplasmic active site.

  • Resistance Development: Target-based resistance through mutations in lnt could emerge, necessitating combination approaches or inhibitors targeting highly conserved regions.

How can fluorescence-based assays be optimized for high-throughput screening of lnt modulators?

The fluorescence-based assay described in the research can be optimized for high-throughput screening (HTS) of lnt modulators through several approaches:

  • Substrate Optimization: The research has shown that no triacyl product is formed when a bulky group such as biotin is attached to the extremity of the transferred fatty acid . This insight allows for the design of optimal fluorescent substrates that maximize signal-to-noise ratio.

  • Miniaturization: Adapting the assay to 384- or 1536-well format would increase throughput while reducing reagent consumption. This requires optimization of:

    • Enzyme concentration to ensure linear reaction kinetics

    • Substrate concentration to balance sensitivity and specificity

    • Incubation times to capture the optimal signal window

  • Automation Integration: Implementation of automated liquid handling systems for reagent dispensing and plate reading would increase consistency and reduce variability.

  • Data Analysis Pipeline: Development of dedicated software for analyzing large datasets from HTS campaigns, including:

    • Statistical parameters for hit identification (Z', signal-to-background ratio)

    • Dose-response curve fitting for potency determination

    • Structure-activity relationship analysis

  • Counter-screens: Development of parallel assays to identify false positives early in the screening cascade, such as testing for compound auto-fluorescence or general membrane disruption.

How does P. syringae lnt compare with homologous enzymes in other bacterial pathogens?

The structural and functional comparison of lnt across bacterial species reveals important evolutionary insights:

These variations may reflect adaptations to different ecological niches and host interactions, particularly relevant for host-specific pathogens like P. syringae pathovars.

What insights can P. syringae phylogenetic studies provide about lnt evolution and specialization?

Pseudomonas syringae is a genetically diverse bacterial species complex responsible for numerous crop diseases, with strains assigned to different pathovars based on host specificity and disease symptoms . Analysis of lnt in this context provides valuable evolutionary insights:

  • Phylogroup-Specific Adaptations: P. syringae strains are categorized into phylogroups (PG) with different host specificity patterns. For example, PG3 strains (pathovar phaseolicola) show higher host specificity than PG2 strains (pathovar syringae) . Analysis of lnt sequence variations between these phylogroups could reveal adaptations associated with host specialization.

  • Selective Pressure Analysis: By examining the ratio of synonymous to non-synonymous substitutions in lnt across phylogroups, researchers can identify regions under positive or purifying selection, indicating functional importance.

  • Horizontal Gene Transfer Assessment: Analysis of lnt sequence similarity patterns that deviate from species phylogeny could indicate horizontal gene transfer events that might have contributed to host adaptation.

  • Correlation with Virulence Patterns: Machine learning approaches that successfully predicted virulence on bean with high accuracy using whole genome data could be focused specifically on lnt variations to determine their contribution to host-specific virulence.

What emerging technologies could advance the study of lnt's role in plant-pathogen interactions?

Several cutting-edge technologies show promise for deepening our understanding of lnt's role in plant-pathogen interactions:

  • CRISPR-Cas9 Genome Editing: Precise modification of lnt in P. syringae to create point mutations affecting specific functional domains, allowing detailed structure-function analysis in planta.

  • Single-Cell Techniques: Application of single-cell RNA-seq and proteomics to study the heterogeneity of lnt expression during different phases of plant infection.

  • Advanced Imaging: Super-resolution microscopy and correlative light-electron microscopy to visualize lnt localization and dynamics during host colonization.

  • Biosensors: Development of FRET-based biosensors to monitor lnt activity in real-time during plant-pathogen interactions.

  • Computational Approaches: Integration of machine learning with structural biology to predict host-specific adaptations in lnt across P. syringae pathovars, building on the success of machine learning in predicting virulence .

How might targeting lnt contribute to sustainable disease management strategies?

Targeting lnt as part of sustainable disease management strategies presents several promising avenues:

  • Selective Inhibitors: Development of small molecules that specifically inhibit lnt could disrupt bacterial membrane integrity while minimizing environmental impact compared to broad-spectrum bactericides.

  • Host Resistance Engineering: Understanding how plants recognize bacterial lipoproteins could guide the engineering of plants with enhanced recognition of lnt-processed lipoproteins, triggering stronger immune responses.

  • Diagnostic Applications: The fluorescence-based assay for lnt activity could be adapted for field diagnostics to rapidly identify P. syringae infections before visible symptoms appear, enabling earlier intervention.

  • Virulence Prediction: Machine learning models that incorporate lnt variations could predict the virulence potential of emerging P. syringae strains , allowing proactive disease management strategies.

  • Attenuated Strains: Engineering P. syringae strains with modified lnt activity as competitive but non-pathogenic field applications that could displace virulent strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.