Recombinant Pseudomonas syringae pv. tomato ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock
Cat. No.
BT2040281
Source
in vitro E.coli expression system
Synonyms
atpE; PSPTO_5604; PSPTO5604; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Quick Inquiry

Description

Overview of Recombinant Pseudomonas syringae pv. tomato ATP Synthase Subunit c (atpE)

Recombinant Pseudomonas syringae pv. tomato ATP synthase subunit c (atpE) is a bacterial protein engineered for research purposes. This protein is a component of the ATP synthase complex, which catalyzes the synthesis of ATP via proton translocation across bacterial membranes. The recombinant version includes an N-terminal His-tag for purification and is expressed in Escherichia coli .

ATP synthase subunit c (atpE) is part of the F₀ subunit, forming a proton channel that drives rotational motion critical for ATP generation. In P. syringae pv. tomato, this enzyme is essential for energy production during infection and environmental adaptation .

Biochemical Assays

  • ATP Synthase Activity: Recombinant atpE could be combined with other subunits (e.g., a, b, c) to reconstitute functional F₀F₁ complexes in vitro.

  • Inhibitor Screening: Testing small molecules targeting ATP synthase activity in P. syringae .

Pathogenicity and Host-Pathogen Interactions

  • Energy Metabolism in Infection: ATP synthase supports bacterial survival during colonization. Disrupting its function may impair virulence.

  • Comparative Studies: Investigating subunit c differences between P. syringae pathovars (e.g., tomato vs. syringae) .

Challenges and Knowledge Gaps

Current literature lacks experimental data on this recombinant protein. Key limitations include:

  • Limited Functional Characterization: No studies confirm enzymatic activity or structural integrity post-recombinant production.

  • Host-Specific Studies: No direct evidence linking P. syringae pv. tomato ATP synthase subunit c to host immune evasion or pathogen fitness.

Supplier Comparison

Commercial availability is limited to specialized biotechnology vendors:

SupplierProduct FeaturesAdvantages
Creative Biomart Full-length His-tagged protein; E. coli expressionReady-to-use format for structural/functional studies
CUSABIO Recombinant protein; unspecified expression systemPotential for bulk production

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our stock. If you have specific requirements for the format, kindly include your request in the order notes and we will accommodate your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
All protein shipments are standardly equipped with blue ice packs. If dry ice shipment is required, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to settle the contents. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our protein products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To ensure optimal stability, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
atpE; PSPTO_5604; PSPTO5604; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-85
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
atpE
Target Protein Sequence
METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEMVPMLQVKMFIVAGLLD AVTMIGVGIALFFTFANPFVGQLAG
Uniprot No.
Q87TS9

Target Background

Function
F(1)F(0) ATP synthase is responsible for ATP production from ADP in the presence of a proton or sodium gradient. This enzyme comprises two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit plays a crucial role in proton translocation across the membrane. A homomeric c-ring, composed of 10-14 subunits, forms the central stalk rotor element, interacting with the F(1) delta and epsilon subunits.
Database Links

KEGG: pst:PSPTO_5604

STRING: 223283.PSPTO_5604

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.