Recombinant Pseudomonas syringae pv. tomato Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The recombinant cobS protein is expressed in E. coli systems for research applications:

  • Expression System: In vitro E. coli expression

  • Tag: N-terminal 10xHis-tag for affinity chromatography

  • Storage:

    • Buffer: Tris-based with 50% glycerol

    • Temperature: -20°C (short-term), -80°C (long-term)

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C for ≤1 week .

Role in Cobalamin Biosynthesis

CobS catalyzes the final step in cobalamin synthesis, converting cobyric acid to cobalamin via adenosylation. This pathway is critical for:

  • Methionine and nucleotide synthesis in bacteria

  • Enzymatic reactions requiring vitamin B12 as a cofactor

Genomic Context

  • Operon Structure: cobS resides in a gene cluster (PSPTO_1713–PSPTO_1717) linked to cobalamin metabolism .

  • Conservation: Orthologs identified in 394 bacterial genera, indicating evolutionary conservation .

Pathogenicity Linkages

While cobS is not directly implicated in virulence, P. syringae pv. tomato DC3000 relies on metabolic pathways involving cobalamin for:

  • Coronatine phytotoxin production

  • Adaptation to plant apoplastic environments

Key Studies

  • Recombineering: P. syringae RecT/RecE systems (used in cobS engineering) enable precise genomic edits via homologous recombination .

  • Effector Studies: cobS is used as a non-virulence control in comparative analyses of type III secreted effectors .

Knowledge Gaps

  • Structural data (e.g., X-ray crystallography) remain unavailable.

  • Direct evidence linking cobS to host-pathogen interactions is limited .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
cobS; PSPTO_1717; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Target Names
cobS
Target Protein Sequence
MLPFWIALQFLGSLPIRLPGMPRPAELGRSLLFYPLVGVVFGTLLLGFNALLSGAPLLLH AALLLSAWVLLSGGLHLDGLADSADAWLGGFGDRERTLNIMKDPRSGPIAVVTLVVVLLL KFAAIVALIESHNSIGLLLAPLIGRSAMLALFLGTPYVRSGGLGQALADHLPRSLGRKVL LVSTVACVVLAGWSGIAALLVCAVCFYWLRHMMMRRLGGSTGDTAGALLELLELAVVLTL ALL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Pseudomonas syringae* pv. tomato catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cobalamin synthase (cobS) in Pseudomonas syringae pv. tomato?

Cobalamin synthase (cobS) in Pseudomonas syringae pv. tomato functions as a key enzyme in the third part of the cobalamin (vitamin B12) biosynthetic pathway. Based on comparative studies with other bacterial species, cobS is involved in the late stages of cobalamin assembly, specifically in the attachment of the lower axial ligand to the corrin ring structure. The enzyme is homologous to the cobS gene in Salmonella and plays an essential role in completing the synthesis of the functional vitamin B12 molecule. Studies of related organisms indicate that cobS functions downstream of the cobU-catalyzed reactions and works in concert with other enzymes to finalize the structure of this complex vitamin .

How is the cobS gene organized within the genome of Pseudomonas syringae pv. tomato?

The cobS gene in Pseudomonas syringae pv. tomato is part of the cobalamin biosynthetic gene cluster. Drawing parallels from studies in Salmonella, the cobS gene would be grouped with other "part III" genes responsible for the final stages of vitamin B12 synthesis. In Salmonella, these genes are arranged within a single operon (cob operon), where genes with similar functions in the pathway are physically clustered together . Specifically, cobS in P. syringae pv. tomato would be expected to be located near other genes involved in the attachment of the lower ligand and completion of the cobalamin molecule, although the exact organization might differ from that of Salmonella due to evolutionary divergence.

What are the structural characteristics of cobS enzyme from Pseudomonas syringae pv. tomato?

The cobS enzyme from Pseudomonas syringae pv. tomato likely shares structural features with its homologs in other species. Based on comparative analysis, it belongs to the family of cobalamin synthases characterized by specific domains for substrate binding and catalysis. The enzyme likely possesses binding sites for its substrates (adenosylcobinamide-GDP and α-ribazole) and catalyzes their joining to form adenosylcobalamin. The enzyme would have structural motifs specialized for recognizing the complex structure of the corrin ring and facilitating the precise attachment of the lower ligand. A comprehensive structural characterization would require X-ray crystallography or cryo-EM studies specifically of the P. syringae pv. tomato enzyme, as subtle structural differences may exist between cobS from different bacterial species .

How do mutations in the cobS gene affect cobalamin biosynthesis in Pseudomonas syringae pv. tomato?

Mutations in the cobS gene of Pseudomonas syringae pv. tomato would likely result in part III defects in the cobalamin biosynthetic pathway, similar to what has been observed in Salmonella. Such mutations would prevent the organism from synthesizing complete cobalamin molecules even when provided with both cobinamide and DMB (5,6-dimethylbenzimidazole) precursors . The specific biochemical consequences would include accumulation of adenosylcobinamide-GDP intermediates and an inability to attach the α-ribazole portion to complete the vitamin B12 structure.

Research approaches to studying these mutations include:

  • Site-directed mutagenesis of conserved residues

  • Complementation assays with wild-type cobS

  • Metabolite profiling to detect accumulated intermediates

  • Growth assays under conditions requiring cobalamin

These approaches would help determine which regions of the enzyme are essential for catalytic activity and substrate binding, providing insights into the structure-function relationship of cobS.

What are the key differences between cobS in Pseudomonas syringae pv. tomato and its homologs in other bacterial species?

Comparative analysis of cobS from P. syringae pv. tomato with its homologs in other bacteria reveals both conserved features and species-specific adaptations. While the core catalytic function is maintained across species, differences may exist in:

FeatureP. syringae pv. tomato cobSSalmonella cobSP. denitrificans cobV
Protein lengthSpecies-specific~250-300 amino acidsSimilar length
Substrate specificityMay be optimized for specific intermediatesWell-characterizedWell-characterized
Regulatory elementsLikely regulated by plant-associated factorsRegulated by pocR gene productDifferent regulatory system
Catalytic efficiencyUnknown, likely optimized for plant-associated lifestyleAdapted to enteric lifestyleAdapted to soil environment

These differences reflect evolutionary adaptations to different ecological niches and metabolic requirements. Research approaches to investigate these differences include phylogenetic analysis, enzyme kinetics studies comparing recombinant enzymes from different species, and complementation assays testing cross-species functionality .

How does environmental stress affect cobS expression and activity in Pseudomonas syringae pv. tomato?

Environmental stressors likely impact cobS expression and activity in P. syringae pv. tomato as part of the organism's adaptation mechanisms. Based on research in related bacteria, several factors may influence cobS function:

  • Oxygen levels - Cobalamin biosynthesis is typically oxygen-sensitive, and the expression of cobS may be regulated by oxygen concentration, similar to how redox state influences the cob operon in Salmonella .

  • Nutrient availability - Limitation of cobalt, the central metal ion in cobalamin, would necessitate regulation of cobS expression to optimize resource allocation.

  • Plant defense responses - As a plant pathogen, P. syringae pv. tomato faces host immune responses that may trigger stress-responsive regulation of metabolic pathways including cobalamin synthesis.

Methodological approaches to study these effects include:

  • qRT-PCR to measure cobS transcript levels under various stressors

  • Reporter gene fusions to monitor promoter activity

  • Recombinant enzyme assays under different in vitro conditions

  • Metabolomic profiling of cobalamin intermediates during stress responses

Understanding these regulatory mechanisms could provide insights into the ecological role of cobalamin production in plant-microbe interactions.

What are the optimal conditions for expressing recombinant cobS from Pseudomonas syringae pv. tomato in E. coli?

Optimal expression of recombinant P. syringae pv. tomato cobS in E. coli requires careful optimization of several parameters:

  • Expression vector selection:

    • pET vectors with T7 promoter systems often yield high expression levels

    • Consider adding affinity tags (His6, GST) for purification while ensuring they don't interfere with enzyme activity

  • Host strain considerations:

    • BL21(DE3) derivatives are commonly used for recombinant protein expression

    • Consider strains with rare codon supplementation if P. syringae cobS contains rare codons

    • Rosetta or CodonPlus strains may improve expression

  • Induction parameters:

    • Temperature: Lower temperatures (16-25°C) often improve folding of complex enzymes

    • IPTG concentration: 0.1-0.5 mM typically sufficient, higher concentrations may lead to inclusion bodies

    • Induction time: 4-16 hours depending on temperature

  • Media optimization:

    • Rich media (LB, TB) for maximum biomass

    • Supplementation with cobalt salt (10-50 μM) may stabilize the enzyme

    • Consider M9 minimal media for isotope labeling if structural studies are planned

  • Solubility enhancement strategies:

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Addition of low concentrations of non-ionic detergents (0.05-0.1% Triton X-100)

These parameters should be systematically tested to develop an optimized expression protocol specific to P. syringae pv. tomato cobS .

What purification strategy is most effective for obtaining active recombinant cobS enzyme?

A multi-step purification strategy is recommended for obtaining highly pure and active recombinant cobS:

  • Initial capture:

    • If His-tagged: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • If GST-tagged: Glutathione-Sepharose affinity chromatography

    • Buffer conditions: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT

  • Intermediate purification:

    • Ion exchange chromatography (IEX) based on theoretical pI of cobS

    • Anion exchange (Q-Sepharose) if pI < 7.0

    • Cation exchange (SP-Sepharose) if pI > 7.0

  • Polishing step:

    • Size exclusion chromatography (Superdex 200) to separate monomeric enzyme from aggregates

    • Buffer: 25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT

  • Activity preservation considerations:

    • Addition of cobalt salt (10 μM CoCl₂) to all buffers

    • Inclusion of reducing agents (1-5 mM DTT or 0.5-2 mM TCEP)

    • Storage with 20% glycerol at -80°C in small aliquots

  • Quality control:

    • SDS-PAGE for purity assessment (>95% for enzymatic studies)

    • Western blot confirmation using anti-His or anti-cobS antibodies

    • Dynamic light scattering to verify monodispersity

    • Circular dichroism to confirm proper folding

This purification workflow should be optimized based on the specific properties of P. syringae pv. tomato cobS and the intended downstream applications .

How can isotope labeling be used to study the mechanism of cobS-catalyzed reactions?

Isotope labeling provides powerful insights into the enzymatic mechanism of cobS catalysis through tracking atom movements during the reaction:

  • Types of isotope labeling for cobS studies:

    • ¹³C labeling of substrate carbon atoms to track carbon rearrangements

    • ¹⁵N labeling to follow nitrogen transfers in the corrin structure

    • ¹⁸O labeling to determine oxygen exchange with solvent

    • Deuterium (²H) labeling to investigate hydrogen transfer steps

  • Preparation of labeled substrates:

    • Chemical synthesis of specifically labeled DMB or cobinamide precursors

    • Enzymatic synthesis using upstream pathway enzymes with labeled precursors

    • Incorporation of isotope labels in vivo using minimal media with labeled precursors

  • Analytical techniques:

    • Nuclear Magnetic Resonance (NMR) spectroscopy:

      • ¹³C-¹³C COSY to track carbon connectivity changes

      • HSQC and HMBC for heteronuclear correlations

      • MAS NMR for solid-state analyses

    • Mass Spectrometry:

      • LC-MS/MS for detection of labeled intermediates

      • High-resolution MS for precise mass shift determination

      • Ion mobility MS for structural characterization

  • Kinetic isotope effect studies:

    • Comparing reaction rates with labeled vs. unlabeled substrates

    • Determining rate-limiting steps in the catalytic cycle

    • Calculation of primary and secondary isotope effects

  • Data interpretation approaches:

    • Computational modeling to predict isotope effects

    • Pathway reconstruction from labeling patterns

    • Integration with structural data for mechanism proposal

These approaches collectively provide a detailed understanding of the chemical transformations catalyzed by cobS during the final stages of cobalamin biosynthesis .

How can issues with recombinant cobS solubility and stability be addressed?

Solubility and stability challenges with recombinant cobS can be addressed through multiple strategies:

  • Expression optimization:

    • Reduce induction temperature to 16-18°C for overnight expression

    • Lower IPTG concentration to 0.1-0.2 mM

    • Use auto-induction media for gradual protein expression

  • Buffer optimization through systematic screening:

    • pH range testing (pH 6.5-8.5 in 0.5 unit increments)

    • Salt concentration variation (100-500 mM NaCl)

    • Addition of stabilizing agents:

      • 5-10% glycerol

      • 0.5-1 mM EDTA (if metal ions cause aggregation)

      • 1-5 mM reducing agents (DTT, TCEP, β-mercaptoethanol)

  • Solubility enhancement additives:

    • Mild detergents: 0.05% Triton X-100, 0.1% CHAPS

    • Amino acid additives: 50 mM arginine, 50 mM glutamate

    • Osmolytes: 0.5-1 M trehalose, 0.5-2 M urea (non-denaturing)

    • Substrate analogs or product molecules at 10-100 μM

  • Protein engineering approaches:

    • Surface entropy reduction by mutation of clusters of flexible charged residues

    • Truncation of flexible termini if they contribute to aggregation

    • Fusion to highly soluble partners (MBP, SUMO, Fh8)

    • Introduction of disulfide bonds to stabilize tertiary structure

  • Storage condition optimization:

    • Test protein stability at different temperatures (4°C, -20°C, -80°C)

    • Evaluate cryoprotectants (10-20% glycerol, 0.5 M trehalose)

    • Lyophilization with appropriate excipients

    • Addition of reducing agents and chelators to prevent oxidation

Systematic application of these approaches, while monitoring enzyme activity, can significantly improve recombinant cobS solubility and stability for downstream applications .

What are common pitfalls in assaying cobS enzymatic activity and how can they be overcome?

Assaying cobS enzymatic activity presents several challenges that can be addressed through careful experimental design:

  • Substrate availability issues:

    • Challenge: Adenosylcobinamide-GDP and α-ribazole are not commercially available

    • Solution: Enzymatic synthesis using upstream pathway enzymes or chemical synthesis with careful characterization

    • Alternative: Use crude extracts from organisms blocked in cobS but with functional upstream enzymes

  • Assay interference problems:

    • Challenge: Components in crude extracts may interfere with activity measurements

    • Solution: Develop specific HPLC or LC-MS methods for product detection

    • Alternative: Use radioisotope-labeled substrates (³²P-GDP or ¹⁴C-labeled precursors) for increased sensitivity

  • Detection sensitivity limitations:

    • Challenge: Low turnover rate of cobS enzyme

    • Solution: Extended incubation times with time-course sampling

    • Alternative: Coupled enzyme assays that link product formation to a more easily detectable signal

  • Enzyme instability during assay:

    • Challenge: Loss of activity during extended incubations

    • Solution: Optimize buffer conditions (pH, ionic strength, reducing agents)

    • Alternative: Immobilization of enzyme on beads or chips to enhance stability

  • Data interpretation complexities:

    • Challenge: Distinguishing enzymatic activity from non-enzymatic reactions

    • Solution: Rigorous controls including heat-inactivated enzyme and substrate-only incubations

    • Alternative: Use of multiple detection methods to confirm product formation

A standardized assay protocol might include:

Assay ComponentConcentration/Condition
Purified cobS0.1-1 μM
Adenosylcobinamide-GDP10-50 μM
α-ribazole10-50 μM
Buffer50 mM HEPES pH 7.5
NaCl100 mM
MgCl₂5 mM
DTT1 mM
Temperature30°C
Time30-60 minutes
DetectionHPLC or LC-MS

These approaches collectively enable reliable measurement of cobS activity despite the inherent challenges of working with this complex enzyme system .

How can contradictory results in cobS function studies be reconciled and validated?

Contradictory results in cobS function studies can arise from multiple sources and require systematic approaches for reconciliation:

  • Sources of contradictions in cobS research:

    • Organism-specific differences between Pseudomonas species and strains

    • Variations in recombinant protein constructs (tags, truncations)

    • Differences in assay conditions and detection methods

    • Substrate quality and purity variations

    • Incomplete enzyme characterization (post-translational modifications)

  • Validation framework for resolving contradictions:

    • Comprehensive literature review identifying specific points of disagreement

    • Direct replication attempts of conflicting studies with identical methodologies

    • Systematic variation of experimental parameters to identify critical factors

    • Use of multiple, orthogonal techniques to confirm results

    • Statistical analysis of reproducibility across independent experiments

  • Specific approaches for cobS function validation:

    • In vivo complementation: Test ability of variant cobS constructs to restore cobalamin synthesis in cobS-deficient strains

    • Metabolite profiling: Quantify pathway intermediates and products using LC-MS/MS

    • Structure-function analysis: Correlate contradictory results with specific protein domains or residues

    • Comparative enzymology: Parallel characterization of cobS from multiple species under identical conditions

    • Integrated data approach: Combine biochemical, genetic, and structural methods

  • Communication and standardization strategies:

    • Detailed reporting of methodologies including buffer compositions and protein sequences

    • Sharing of materials (strains, plasmids) between laboratories

    • Development of standard operating procedures for cobS assays

    • Pre-registration of experimental designs to reduce confirmation bias

    • Collaborative cross-laboratory validation studies

These approaches collectively provide a systematic framework for reconciling contradictory results and establishing consensus on cobS function across different experimental systems and organisms .

What potential applications exist for engineered variants of Pseudomonas syringae pv. tomato cobS?

Engineered variants of P. syringae pv. tomato cobS offer several promising research and biotechnological applications:

  • Enhanced cobalamin production systems:

    • Rational engineering of cobS to improve catalytic efficiency

    • Creation of thermostable variants for industrial processes

    • Development of cobS variants with broader substrate specificity

  • Biosensor development:

    • cobS-based detection systems for cobalamin pathway intermediates

    • Integration into whole-cell biosensors for environmental monitoring

    • Creation of FRET-based sensors using cobS conformational changes

  • Synthetic biology applications:

    • Incorporation into artificial cobalamin biosynthetic pathways

    • Development of orthogonal cobalamin-dependent gene regulation systems

    • Engineering of minimal cobalamin production systems for heterologous hosts

  • Structural biology platforms:

    • Creation of stabilized cobS variants for crystallization studies

    • Development of conformationally restricted mutants to capture catalytic intermediates

    • Production of labeled variants for NMR-based structural studies

  • Plant-microbe interaction research:

    • Investigation of cobS role in P. syringae virulence

    • Study of cobalamin as a potential signaling molecule in plant-pathogen interactions

    • Development of cobS-targeting antimicrobials specific to plant pathogens

These applications represent promising avenues for future research, extending beyond the basic characterization of cobS to applied contexts in biotechnology, synthetic biology, and agricultural research .

How might high-throughput approaches advance our understanding of cobS function and evolution?

High-throughput approaches offer powerful tools to accelerate research on cobS function and evolution:

  • Sequence-function mapping using deep mutational scanning:

    • Creation of comprehensive cobS mutant libraries

    • Parallel functional assays to identify critical residues

    • Correlation of mutational effects with structural features

  • Comparative genomics and evolutionary analyses:

    • Systematic comparison of cobS across bacterial phyla

    • Identification of co-evolving residues within cobalamin biosynthesis pathways

    • Reconstruction of evolutionary trajectories of cobS specialization

  • High-throughput crystallography and structural biology:

    • Parallel crystallization trials under hundreds of conditions

    • Fragment-based screening for ligand binding sites

    • Cryo-EM analysis of cobS in different functional states

  • Systems biology integration:

    • Multi-omics profiling of cobS mutants

    • Network analysis of cobS interactions with other cellular components

    • Flux balance analysis to quantify impacts on cellular metabolism

  • Automated enzyme assay development:

    • Miniaturized assays in 384 or 1536-well formats

    • Microfluidic droplet-based enzyme evolution systems

    • Continuous monitoring systems for real-time activity measurement

Implementation plan for a high-throughput cobS research program:

PhaseApproachExpected OutcomeTimeline
1Library generation of cobS variants>10,000 sequence variants3-6 months
2Development of high-throughput activity assaysValidated screening platform2-4 months
3Parallel functional characterizationComprehensive sequence-function map6-12 months
4Structural analysis of key variantsMechanism insights6-12 months
5Evolutionary analysis and modelingEvolutionary trajectory model3-6 months

These high-throughput approaches would significantly accelerate our understanding of cobS function, potentially yielding in months insights that might otherwise require years of traditional experimentation .

What role might cobS play in developing new antimicrobial strategies against plant pathogens?

The cobS enzyme represents a promising target for developing novel antimicrobial strategies against Pseudomonas syringae pv. tomato and other plant pathogens:

  • Target validation approaches:

    • Generation of cobS knockout mutants to assess virulence phenotypes

    • Plant infection studies comparing wild-type and cobS-deficient strains

    • Metabolomic analysis of cobalamin-dependent processes during infection

  • Inhibitor development strategies:

    • Structure-based design of cobS-specific inhibitors

    • High-throughput screening of chemical libraries

    • Fragment-based drug discovery targeting cobS active site

    • Repurposing of inhibitors developed against homologous enzymes

  • Delivery systems for agricultural applications:

    • Nanoparticle formulations for improved stability

    • Plant-systemic compounds that accumulate at infection sites

    • Seed treatment technologies for preventative protection

    • Integration with existing agricultural management practices

  • Resistance management considerations:

    • Assessment of potential resistance mechanisms

    • Development of multi-target strategies combining cobS inhibition with other modes of action

    • Evolutionary modeling to predict and counter resistance development

  • Benefits over conventional antimicrobials:

    • Specificity to cobalamin-synthesizing pathogens

    • Reduced impact on beneficial soil and plant microbiota

    • Novel mode of action to address resistance to existing antimicrobials

    • Potential for reduced environmental impact

Inhibitor development pathway:

StageActivitiesSuccess CriteriaTimeline
Target validationIn vitro and in planta studiesConfirmed role in virulence6-12 months
Assay developmentBiochemical and cell-based screening systemsZ-factor > 0.73-6 months
Primary screeningTesting of 100,000+ compounds>100 hits with IC₅₀ < 10 μM6-12 months
Hit-to-lead optimizationMedicinal chemistry and SAR studiesCompounds with IC₅₀ < 1 μM12-24 months
In planta validationGreenhouse and field studies>80% disease reduction12-24 months

This research direction represents a promising approach to developing targeted antimicrobials that could help address the growing challenge of plant disease management in sustainable agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.